SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062TZA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062TZA0
Domain Number 1 Region: 5-164
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 8.11e-53
Family N-acetylmuramoyl-L-alanine amidase-like 0.000023
Further Details:      
 
Domain Number 2 Region: 176-240
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000131
Family Peptidoglycan binding domain, PGBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A062TZA0
Sequence length 252
Comment (tr|A0A062TZA0|A0A062TZA0_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:KCZ48093.1} KW=Complete proteome; Reference proteome OX=1280941 OS=Hyphomonas sp. T16B2. GN=HY2_16130 OC=Hyphomonadaceae; Hyphomonas.
Sequence
MQTDSVESPNFNARRHALDMLVLHYTGMESGEAALQRMCDPAAEVSAHYMVWEDGRITQL
VQEDQRAWHAGVSRWQDDDDLNSRSIGIEIVNGGHDVPLPNGRLPPYPDAQIAAVIALSK
DILSRHAIRPSRIVGHSDIAPARKIDPGEHFPWDRLAAEGIGYWPDLPAMSGRDGGSLLP
GDTGKHVEHLQSVLRGIGYELAVDGIYSDETASIVRAFQRRWLPLQLTGHTDAGTLARIA
QIHTGLEASSSS
Download sequence
Identical sequences A0A062TZA0
WP_034828460.1.86936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]