SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A062U8I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062U8I6
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000167
Family Anti-sigma factor antagonist SpoIIaa 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A062U8I6
Sequence length 364
Comment (tr|A0A062U8I6|A0A062U8I6_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:KCZ54053.1} KW=Complete proteome OX=1280946 OS=Hyphomonas beringensis. GN=HY29_03000 OC=Hyphomonadaceae; Hyphomonas.
Sequence
METSDEETILHVSGDWTVRTVQAVDADLRALSHTGRVVLDVSELGQLDTAGAFVLDRTAR
QLSDDEPEIRGQHSVADNLISQVHAVTDVEEPKRKRSGGLIDMLERTGRGVHHVLQEGVA
TLAFLGETMVTTTRLLLTPWKLRWTSIVAVMEEAGLDAMPIVAFLSFFVGLVVAFIGATT
LRDLGSQVFTVELVGYAMFRELGVLLTGIVLAGRTNSSFTAQIGTMKMRQELDAMQTLGL
KPMEVLVTPRIIAMVVVTPVLAFVGTLSGVLGGIIVSWLTLDINPTLFLDRLQNTVPIEQ
FWIGMSKAPVFGFVVALIACRQGLNVGGSVQSLGSKTTTSVVQAIFSIIVIDALFAIFYM
EMGL
Download sequence
Identical sequences A0A062U8I6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]