SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062VD40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062VD40
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.00000000000432
Family HEPN domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A062VD40
Sequence length 77
Comment (tr|A0A062VD40|A0A062VD40_9EURY) Uncharacterized protein {ECO:0000313|EMBL:KCZ73175.1} KW=Complete proteome; Reference proteome OX=1392998 OS=Candidatus Methanoperedens nitroreducens. GN=ANME2D_00235 OC=Candidatus Methanoperedenaceae; Candidatus Methanoperedens.
Sequence
MDNRDVARSWFKKGNNDLIVAEHVLIMQNPPTDTICFHSQQAAEKYLKGFLAFHGKETPK
IHDLEEFISACKEIDSE
Download sequence
Identical sequences A0A062VD40
WP_052368498.1.47093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]