SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062X2I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062X2I4
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily YajQ-like 6.93e-28
Family YajQ-like 0.0011
Further Details:      
 
Domain Number 2 Region: 90-162
Classification Level Classification E-value
Superfamily YajQ-like 3.14e-25
Family YajQ-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A062X2I4
Sequence length 162
Comment (tr|A0A062X2I4|A0A062X2I4_9ACTN) UPF0234 protein BMG523Draft_00077 {ECO:0000256|HAMAP-Rule:MF_00632} KW=Complete proteome OX=683305 OS=Frankia sp. BMG5.23. GN=BMG523Draft_00077 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MADPSFDIVSKVDAQEIDNAVNQTVKEIRTRFDFRDTGASATLSGESILLVANTDERVKA
VLDVLQEKFVKRGISLKALTFDEPKPSGKEFRLPVTVQQGIAEDKAKAIAKKIRTDGPKG
VQAQIQGDQLRVTGKKRDDLQRVIQILKTEDFEVPLQFVNYR
Download sequence
Identical sequences A0A062X2I4 Q2JFK0 W9D7S0
WP_011435018.1.23478 WP_011435018.1.33095 WP_011435018.1.5445 WP_011435018.1.57996 WP_011435018.1.61086 WP_011435018.1.64980 WP_011435018.1.79022 WP_011435018.1.98991 WP_011435018.1.9943 gi|86739271|ref|YP_479671.1| 106370.Francci3_0558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]