SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A062XEK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A062XEK9
Domain Number - Region: 5-32
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0288
Family KorB DNA-binding domain-like 0.016
Further Details:      
 
Domain Number - Region: 37-68
Classification Level Classification E-value
Superfamily MIR domain 0.034
Family MIR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A062XEK9
Sequence length 80
Comment (tr|A0A062XEK9|A0A062XEK9_LEUPS) Uncharacterized protein {ECO:0000313|EMBL:KDA49228.1} KW=Complete proteome; Reference proteome OX=1339247 OS=Leuconostoc pseudomesenteroides PS12. GN=L965_1554 OC=Leuconostoc.
Sequence
MSHLAIEDVAAALNTSVSKINQILELDHVAPEDPWILKEYLSEQLFQQGLTGYPYSKLVG
DFRNYWFLSTRKIYKRQLSK
Download sequence
Identical sequences A0A062XEK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]