SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A062Y8S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062Y8S6
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.11e-75
Family Methylesterase CheB, C-terminal domain 0.0000000108
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.01e-27
Family CheY-related 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A062Y8S6
Sequence length 349
Comment (tr|A0A062Y8S6|A0A062Y8S6_ECOLX) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1444037 OS=Escherichia coli 2-011-08_S1_C1. GN=AA98_2019 OC=Enterobacteriaceae; Escherichia.
Sequence
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
Download sequence
Identical sequences A0A023YYN0 A0A024KXS3 A0A025CNJ8 A0A026UX05 A0A062Y8S6 A0A064TPE4 A0A070VDP5 A0A080J295 A0A0A0FEL1 A0A0E0V6A5 A0A0E1T1R9 A0A0H3EIG3 A0A0H3MFM3 A0A0H7JAU9 A0A140N8Q0 A0A142H3X7 A0A181WQ50 A0A192C736 A0A1X3I5F3 A0A1X3IMX5 A0A1X3LYS6 A0A237L3M6 A0A2A2XKJ2 A0A2D0P666 B7NBN3 B7USQ9 D6IBJ4 D6JAG4 D7X9D3 D7XP66 D7Z8U3 D8A321 D8E6S8 E1JFQ3 E2QN86 E3PAI6 E3XP98 E6BEG1 E7T4F7 E9XIW0 E9YP80 F3WJI1 F4TFL6 H4IC77 H4ISX5 H4J973 H4KI06 H4LCX4 I2RGJ2 I4SU81 J7RU31 L3QLK2 Q3Z2R1 Q8FGP5 S0XRP0 S0YSD9 S1D6Z6 S1EW70 S1H7H1 S1HW96 S1I630 T5ZE74 T6M6Y5 T9B7G2 T9D480 U9YSR2 U9Z1Y5 U9Z5N0 U9ZKD3 V0W697 V0ZHK2 V8KTB3 W1BGT6 W9AGE4
gi|556551864|ref|YP_008722026.1| gi|170019772|ref|YP_001724726.1| gi|218699546|ref|YP_002407175.1| gi|253773160|ref|YP_003035991.1| gi|383177869|ref|YP_005455874.1| gi|74311767|ref|YP_310186.1| gi|218705383|ref|YP_002412902.1| WP_000036371.1.100014 WP_000036371.1.100044 WP_000036371.1.100063 WP_000036371.1.100111 WP_000036371.1.100135 WP_000036371.1.100138 WP_000036371.1.100159 WP_000036371.1.100194 WP_000036371.1.100220 WP_000036371.1.100227 WP_000036371.1.100251 WP_000036371.1.100281 WP_000036371.1.100285 WP_000036371.1.100304 WP_000036371.1.100306 WP_000036371.1.100315 WP_000036371.1.100389 WP_000036371.1.100444 WP_000036371.1.100448 WP_000036371.1.100451 WP_000036371.1.100474 WP_000036371.1.10048 WP_000036371.1.100487 WP_000036371.1.100496 WP_000036371.1.100531 WP_000036371.1.100725 WP_000036371.1.100753 WP_000036371.1.100803 WP_000036371.1.100851 WP_000036371.1.100852 WP_000036371.1.100868 WP_000036371.1.100916 WP_000036371.1.10094 WP_000036371.1.100950 WP_000036371.1.100966 WP_000036371.1.10100 WP_000036371.1.101087 WP_000036371.1.1011 WP_000036371.1.101121 WP_000036371.1.101148 WP_000036371.1.101175 WP_000036371.1.101214 WP_000036371.1.101313 WP_000036371.1.10138 WP_000036371.1.101387 WP_000036371.1.101399 WP_000036371.1.101429 WP_000036371.1.101430 WP_000036371.1.101439 WP_000036371.1.101445 WP_000036371.1.101486 WP_000036371.1.101586 WP_000036371.1.101594 WP_000036371.1.101693 WP_000036371.1.101700 WP_000036371.1.101769 WP_000036371.1.101777 WP_000036371.1.101855 WP_000036371.1.101887 WP_000036371.1.101889 WP_000036371.1.101900 WP_000036371.1.101932 WP_000036371.1.101937 WP_000036371.1.101940 WP_000036371.1.101942 WP_000036371.1.101948 WP_000036371.1.101962 WP_000036371.1.101964 WP_000036371.1.101984 WP_000036371.1.102021 WP_000036371.1.102036 WP_000036371.1.102076 WP_000036371.1.102093 WP_000036371.1.102104 WP_000036371.1.102106 WP_000036371.1.10222 WP_000036371.1.10233 WP_000036371.1.10235 WP_000036371.1.10329 WP_000036371.1.10348 WP_000036371.1.10352 WP_000036371.1.1040 WP_000036371.1.10496 WP_000036371.1.10508 WP_000036371.1.10524 WP_000036371.1.10525 WP_000036371.1.10573 WP_000036371.1.10576 WP_000036371.1.1058 WP_000036371.1.10605 WP_000036371.1.10628 WP_000036371.1.10705 WP_000036371.1.1071 WP_000036371.1.10715 WP_000036371.1.10744 WP_000036371.1.10748 WP_000036371.1.10771 WP_000036371.1.10786 WP_000036371.1.10787 WP_000036371.1.10824 WP_000036371.1.10849 WP_000036371.1.10862 WP_000036371.1.10869 WP_000036371.1.10988 WP_000036371.1.10995 WP_000036371.1.11052 WP_000036371.1.11068 WP_000036371.1.11118 WP_000036371.1.11241 WP_000036371.1.11251 WP_000036371.1.11265 WP_000036371.1.11272 WP_000036371.1.11315 WP_000036371.1.11323 WP_000036371.1.11411 WP_000036371.1.11418 WP_000036371.1.11437 WP_000036371.1.11440 WP_000036371.1.11452 WP_000036371.1.11467 WP_000036371.1.11499 WP_000036371.1.11542 WP_000036371.1.11575 WP_000036371.1.11595 WP_000036371.1.11607 WP_000036371.1.11612 WP_000036371.1.11673 WP_000036371.1.1176 WP_000036371.1.11801 WP_000036371.1.11803 WP_000036371.1.11956 WP_000036371.1.1196 WP_000036371.1.12000 WP_000036371.1.12060 WP_000036371.1.12095 WP_000036371.1.12115 WP_000036371.1.12151 WP_000036371.1.12174 WP_000036371.1.12204 WP_000036371.1.12230 WP_000036371.1.12268 WP_000036371.1.12292 WP_000036371.1.12295 WP_000036371.1.12352 WP_000036371.1.12426 WP_000036371.1.12459 WP_000036371.1.12468 WP_000036371.1.12566 WP_000036371.1.12574 WP_000036371.1.12594 WP_000036371.1.12646 WP_000036371.1.12675 WP_000036371.1.12693 WP_000036371.1.12697 WP_000036371.1.12766 WP_000036371.1.1278 WP_000036371.1.1280 WP_000036371.1.12826 WP_000036371.1.12893 WP_000036371.1.12917 WP_000036371.1.12944 WP_000036371.1.12956 WP_000036371.1.12976 WP_000036371.1.12987 WP_000036371.1.12991 WP_000036371.1.13002 WP_000036371.1.13015 WP_000036371.1.1308 WP_000036371.1.13117 WP_000036371.1.13136 WP_000036371.1.13205 WP_000036371.1.13258 WP_000036371.1.13272 WP_000036371.1.13278 WP_000036371.1.13295 WP_000036371.1.13346 WP_000036371.1.13383 WP_000036371.1.13393 WP_000036371.1.13409 WP_000036371.1.13411 WP_000036371.1.13451 WP_000036371.1.13469 WP_000036371.1.13473 WP_000036371.1.13566 WP_000036371.1.13589 WP_000036371.1.13608 WP_000036371.1.13624 WP_000036371.1.13626 WP_000036371.1.13644 WP_000036371.1.13664 WP_000036371.1.13672 WP_000036371.1.13740 WP_000036371.1.13778 WP_000036371.1.13824 WP_000036371.1.13891 WP_000036371.1.13934 WP_000036371.1.13974 WP_000036371.1.13981 WP_000036371.1.14030 WP_000036371.1.14042 WP_000036371.1.14070 WP_000036371.1.14094 WP_000036371.1.14127 WP_000036371.1.14154 WP_000036371.1.142 WP_000036371.1.14245 WP_000036371.1.14292 WP_000036371.1.14299 WP_000036371.1.14322 WP_000036371.1.14371 WP_000036371.1.1438 WP_000036371.1.14389 WP_000036371.1.14451 WP_000036371.1.14468 WP_000036371.1.14499 WP_000036371.1.14581 WP_000036371.1.14600 WP_000036371.1.14605 WP_000036371.1.14616 WP_000036371.1.14648 WP_000036371.1.14687 WP_000036371.1.1470 WP_000036371.1.14746 WP_000036371.1.14749 WP_000036371.1.14861 WP_000036371.1.14879 WP_000036371.1.14914 WP_000036371.1.14946 WP_000036371.1.14958 WP_000036371.1.14965 WP_000036371.1.15007 WP_000036371.1.1508 WP_000036371.1.15090 WP_000036371.1.15117 WP_000036371.1.15148 WP_000036371.1.15191 WP_000036371.1.15193 WP_000036371.1.15245 WP_000036371.1.15252 WP_000036371.1.15287 WP_000036371.1.15304 WP_000036371.1.15347 WP_000036371.1.15453 WP_000036371.1.15464 WP_000036371.1.1550 WP_000036371.1.15538 WP_000036371.1.15565 WP_000036371.1.15624 WP_000036371.1.15654 WP_000036371.1.15740 WP_000036371.1.15762 WP_000036371.1.15771 WP_000036371.1.1580 WP_000036371.1.15855 WP_000036371.1.15863 WP_000036371.1.15869 WP_000036371.1.15894 WP_000036371.1.15949 WP_000036371.1.15951 WP_000036371.1.16010 WP_000036371.1.16015 WP_000036371.1.16034 WP_000036371.1.1604 WP_000036371.1.16067 WP_000036371.1.1609 WP_000036371.1.16102 WP_000036371.1.16154 WP_000036371.1.16188 WP_000036371.1.16270 WP_000036371.1.16303 WP_000036371.1.1634 WP_000036371.1.16396 WP_000036371.1.16482 WP_000036371.1.16500 WP_000036371.1.16539 WP_000036371.1.16604 WP_000036371.1.16612 WP_000036371.1.16640 WP_000036371.1.16667 WP_000036371.1.16669 WP_000036371.1.16685 WP_000036371.1.16700 WP_000036371.1.16705 WP_000036371.1.16721 WP_000036371.1.16766 WP_000036371.1.16798 WP_000036371.1.16807 WP_000036371.1.16818 WP_000036371.1.16843 WP_000036371.1.16894 WP_000036371.1.16927 WP_000036371.1.16970 WP_000036371.1.16979 WP_000036371.1.16992 WP_000036371.1.17014 WP_000036371.1.17028 WP_000036371.1.17042 WP_000036371.1.17061 WP_000036371.1.17085 WP_000036371.1.17089 WP_000036371.1.17101 WP_000036371.1.17102 WP_000036371.1.17119 WP_000036371.1.17150 WP_000036371.1.17153 WP_000036371.1.17186 WP_000036371.1.17205 WP_000036371.1.17206 WP_000036371.1.17216 WP_000036371.1.17230 WP_000036371.1.1726 WP_000036371.1.17282 WP_000036371.1.17290 WP_000036371.1.17300 WP_000036371.1.17301 WP_000036371.1.17325 WP_000036371.1.17360 WP_000036371.1.17389 WP_000036371.1.17432 WP_000036371.1.17441 WP_000036371.1.17496 WP_000036371.1.17534 WP_000036371.1.1755 WP_000036371.1.17568 WP_000036371.1.17570 WP_000036371.1.17577 WP_000036371.1.17701 WP_000036371.1.1772 WP_000036371.1.17757 WP_000036371.1.17765 WP_000036371.1.17769 WP_000036371.1.1778 WP_000036371.1.17831 WP_000036371.1.17836 WP_000036371.1.17849 WP_000036371.1.17889 WP_000036371.1.17925 WP_000036371.1.17961 WP_000036371.1.18000 WP_000036371.1.18024 WP_000036371.1.18050 WP_000036371.1.18064 WP_000036371.1.18118 WP_000036371.1.18133 WP_000036371.1.1821 WP_000036371.1.18229 WP_000036371.1.18275 WP_000036371.1.18311 WP_000036371.1.18329 WP_000036371.1.18348 WP_000036371.1.18354 WP_000036371.1.18383 WP_000036371.1.18394 WP_000036371.1.18420 WP_000036371.1.18472 WP_000036371.1.18511 WP_000036371.1.18519 WP_000036371.1.18550 WP_000036371.1.18556 WP_000036371.1.18583 WP_000036371.1.18617 WP_000036371.1.18628 WP_000036371.1.18651 WP_000036371.1.18655 WP_000036371.1.18699 WP_000036371.1.18726 WP_000036371.1.1873 WP_000036371.1.18794 WP_000036371.1.18801 WP_000036371.1.18806 WP_000036371.1.18843 WP_000036371.1.18858 WP_000036371.1.18876 WP_000036371.1.18908 WP_000036371.1.18936 WP_000036371.1.1903 WP_000036371.1.19036 WP_000036371.1.19075 WP_000036371.1.19113 WP_000036371.1.19114 WP_000036371.1.19122 WP_000036371.1.1915 WP_000036371.1.19150 WP_000036371.1.19153 WP_000036371.1.19171 WP_000036371.1.19206 WP_000036371.1.19315 WP_000036371.1.19338 WP_000036371.1.19347 WP_000036371.1.19361 WP_000036371.1.19441 WP_000036371.1.19465 WP_000036371.1.19478 WP_000036371.1.19487 WP_000036371.1.1952 WP_000036371.1.19534 WP_000036371.1.19547 WP_000036371.1.19593 WP_000036371.1.1960 WP_000036371.1.19602 WP_000036371.1.19649 WP_000036371.1.19654 WP_000036371.1.19655 WP_000036371.1.19691 WP_000036371.1.19758 WP_000036371.1.19761 WP_000036371.1.19795 WP_000036371.1.19830 WP_000036371.1.19838 WP_000036371.1.19845 WP_000036371.1.19861 WP_000036371.1.19873 WP_000036371.1.19878 WP_000036371.1.19889 WP_000036371.1.19940 WP_000036371.1.19945 WP_000036371.1.19972 WP_000036371.1.19994 WP_000036371.1.20025 WP_000036371.1.20096 WP_000036371.1.20133 WP_000036371.1.20151 WP_000036371.1.20166 WP_000036371.1.20170 WP_000036371.1.20178 WP_000036371.1.20192 WP_000036371.1.2022 WP_000036371.1.20224 WP_000036371.1.20230 WP_000036371.1.20238 WP_000036371.1.20289 WP_000036371.1.20290 WP_000036371.1.20308 WP_000036371.1.20318 WP_000036371.1.20331 WP_000036371.1.20370 WP_000036371.1.20445 WP_000036371.1.20506 WP_000036371.1.20515 WP_000036371.1.20536 WP_000036371.1.20565 WP_000036371.1.20609 WP_000036371.1.20636 WP_000036371.1.20668 WP_000036371.1.20691 WP_000036371.1.20741 WP_000036371.1.2075 WP_000036371.1.20765 WP_000036371.1.20784 WP_000036371.1.20813 WP_000036371.1.20831 WP_000036371.1.20841 WP_000036371.1.2089 WP_000036371.1.2093 WP_000036371.1.20943 WP_000036371.1.20958 WP_000036371.1.20962 WP_000036371.1.20982 WP_000036371.1.21017 WP_000036371.1.21022 WP_000036371.1.21059 WP_000036371.1.21129 WP_000036371.1.2113 WP_000036371.1.21131 WP_000036371.1.21152 WP_000036371.1.21171 WP_000036371.1.21197 WP_000036371.1.21236 WP_000036371.1.21251 WP_000036371.1.21255 WP_000036371.1.21266 WP_000036371.1.21277 WP_000036371.1.21305 WP_000036371.1.21378 WP_000036371.1.2142 WP_000036371.1.21450 WP_000036371.1.21455 WP_000036371.1.21526 WP_000036371.1.21537 WP_000036371.1.21578 WP_000036371.1.21614 WP_000036371.1.21637 WP_000036371.1.2164 WP_000036371.1.21661 WP_000036371.1.21673 WP_000036371.1.21727 WP_000036371.1.21756 WP_000036371.1.21762 WP_000036371.1.21773 WP_000036371.1.21811 WP_000036371.1.21887 WP_000036371.1.21895 WP_000036371.1.2198 WP_000036371.1.22088 WP_000036371.1.22161 WP_000036371.1.22203 WP_000036371.1.22268 WP_000036371.1.22272 WP_000036371.1.22293 WP_000036371.1.22314 WP_000036371.1.2232 WP_000036371.1.22325 WP_000036371.1.22359 WP_000036371.1.22363 WP_000036371.1.22431 WP_000036371.1.22450 WP_000036371.1.22464 WP_000036371.1.22470 WP_000036371.1.22501 WP_000036371.1.22543 WP_000036371.1.22571 WP_000036371.1.22572 WP_000036371.1.22574 WP_000036371.1.22576 WP_000036371.1.22579 WP_000036371.1.22602 WP_000036371.1.22632 WP_000036371.1.22641 WP_000036371.1.22649 WP_000036371.1.22667 WP_000036371.1.22690 WP_000036371.1.22756 WP_000036371.1.22759 WP_000036371.1.22765 WP_000036371.1.22809 WP_000036371.1.22814 WP_000036371.1.22824 WP_000036371.1.22827 WP_000036371.1.22846 WP_000036371.1.22875 WP_000036371.1.22917 WP_000036371.1.22961 WP_000036371.1.22988 WP_000036371.1.22990 WP_000036371.1.23044 WP_000036371.1.23045 WP_000036371.1.23057 WP_000036371.1.23062 WP_000036371.1.23081 WP_000036371.1.23105 WP_000036371.1.23109 WP_000036371.1.23120 WP_000036371.1.23257 WP_000036371.1.23270 WP_000036371.1.23282 WP_000036371.1.23293 WP_000036371.1.23330 WP_000036371.1.23351 WP_000036371.1.23352 WP_000036371.1.23383 WP_000036371.1.23386 WP_000036371.1.23435 WP_000036371.1.23443 WP_000036371.1.23456 WP_000036371.1.23522 WP_000036371.1.2353 WP_000036371.1.23549 WP_000036371.1.23554 WP_000036371.1.23561 WP_000036371.1.23563 WP_000036371.1.23584 WP_000036371.1.2362 WP_000036371.1.23625 WP_000036371.1.23660 WP_000036371.1.23676 WP_000036371.1.23700 WP_000036371.1.23724 WP_000036371.1.23729 WP_000036371.1.23752 WP_000036371.1.23765 WP_000036371.1.23795 WP_000036371.1.23840 WP_000036371.1.23855 WP_000036371.1.23869 WP_000036371.1.23881 WP_000036371.1.23886 WP_000036371.1.23890 WP_000036371.1.23914 WP_000036371.1.23931 WP_000036371.1.23971 WP_000036371.1.24 WP_000036371.1.24045 WP_000036371.1.24051 WP_000036371.1.24058 WP_000036371.1.24120 WP_000036371.1.24127 WP_000036371.1.2413 WP_000036371.1.24136 WP_000036371.1.24177 WP_000036371.1.24290 WP_000036371.1.24316 WP_000036371.1.2437 WP_000036371.1.24458 WP_000036371.1.2449 WP_000036371.1.24499 WP_000036371.1.24533 WP_000036371.1.24536 WP_000036371.1.2456 WP_000036371.1.24560 WP_000036371.1.24570 WP_000036371.1.24577 WP_000036371.1.24592 WP_000036371.1.24634 WP_000036371.1.24641 WP_000036371.1.2469 WP_000036371.1.24763 WP_000036371.1.24773 WP_000036371.1.24783 WP_000036371.1.24791 WP_000036371.1.24797 WP_000036371.1.24799 WP_000036371.1.24854 WP_000036371.1.24899 WP_000036371.1.24906 WP_000036371.1.24909 WP_000036371.1.24926 WP_000036371.1.24968 WP_000036371.1.24979 WP_000036371.1.24981 WP_000036371.1.24982 WP_000036371.1.24984 WP_000036371.1.2502 WP_000036371.1.25042 WP_000036371.1.25060 WP_000036371.1.25087 WP_000036371.1.25126 WP_000036371.1.25141 WP_000036371.1.25193 WP_000036371.1.25204 WP_000036371.1.25248 WP_000036371.1.25272 WP_000036371.1.25289 WP_000036371.1.2531 WP_000036371.1.25312 WP_000036371.1.25324 WP_000036371.1.25346 WP_000036371.1.2537 WP_000036371.1.25372 WP_000036371.1.25380 WP_000036371.1.254 WP_000036371.1.25403 WP_000036371.1.25420 WP_000036371.1.25446 WP_000036371.1.25480 WP_000036371.1.255 WP_000036371.1.25517 WP_000036371.1.25598 WP_000036371.1.25602 WP_000036371.1.25612 WP_000036371.1.25643 WP_000036371.1.25652 WP_000036371.1.2567 WP_000036371.1.25680 WP_000036371.1.25681 WP_000036371.1.25701 WP_000036371.1.25717 WP_000036371.1.25718 WP_000036371.1.25753 WP_000036371.1.25832 WP_000036371.1.25855 WP_000036371.1.25869 WP_000036371.1.25873 WP_000036371.1.2589 WP_000036371.1.25890 WP_000036371.1.25895 WP_000036371.1.25915 WP_000036371.1.25996 WP_000036371.1.26048 WP_000036371.1.26076 WP_000036371.1.2612 WP_000036371.1.26131 WP_000036371.1.26135 WP_000036371.1.26150 WP_000036371.1.26189 WP_000036371.1.26196 WP_000036371.1.26262 WP_000036371.1.26284 WP_000036371.1.26304 WP_000036371.1.26379 WP_000036371.1.26398 WP_000036371.1.26401 WP_000036371.1.26467 WP_000036371.1.26517 WP_000036371.1.26570 WP_000036371.1.26575 WP_000036371.1.26579 WP_000036371.1.26609 WP_000036371.1.2665 WP_000036371.1.26766 WP_000036371.1.26837 WP_000036371.1.26839 WP_000036371.1.26932 WP_000036371.1.2694 WP_000036371.1.26950 WP_000036371.1.26987 WP_000036371.1.26995 WP_000036371.1.2700 WP_000036371.1.27043 WP_000036371.1.27091 WP_000036371.1.27098 WP_000036371.1.27101 WP_000036371.1.27105 WP_000036371.1.27175 WP_000036371.1.27214 WP_000036371.1.27280 WP_000036371.1.27283 WP_000036371.1.27367 WP_000036371.1.27373 WP_000036371.1.27396 WP_000036371.1.27401 WP_000036371.1.27504 WP_000036371.1.27580 WP_000036371.1.27585 WP_000036371.1.27683 WP_000036371.1.27741 WP_000036371.1.27774 WP_000036371.1.27786 WP_000036371.1.27797 WP_000036371.1.2782 WP_000036371.1.27871 WP_000036371.1.27913 WP_000036371.1.27998 WP_000036371.1.28026 WP_000036371.1.28102 WP_000036371.1.28128 WP_000036371.1.28145 WP_000036371.1.28156 WP_000036371.1.28167 WP_000036371.1.28168 WP_000036371.1.28184 WP_000036371.1.28268 WP_000036371.1.28314 WP_000036371.1.28318 WP_000036371.1.28322 WP_000036371.1.28345 WP_000036371.1.28349 WP_000036371.1.2838 WP_000036371.1.28401 WP_000036371.1.28414 WP_000036371.1.28433 WP_000036371.1.28461 WP_000036371.1.28496 WP_000036371.1.28509 WP_000036371.1.28544 WP_000036371.1.28639 WP_000036371.1.28711 WP_000036371.1.28723 WP_000036371.1.28742 WP_000036371.1.28762 WP_000036371.1.28769 WP_000036371.1.28791 WP_000036371.1.28829 WP_000036371.1.28835 WP_000036371.1.28982 WP_000036371.1.290 WP_000036371.1.29049 WP_000036371.1.29061 WP_000036371.1.29079 WP_000036371.1.29146 WP_000036371.1.29194 WP_000036371.1.29197 WP_000036371.1.29252 WP_000036371.1.29258 WP_000036371.1.2926 WP_000036371.1.29341 WP_000036371.1.29394 WP_000036371.1.29429 WP_000036371.1.2945 WP_000036371.1.29486 WP_000036371.1.29497 WP_000036371.1.29523 WP_000036371.1.29556 WP_000036371.1.2963 WP_000036371.1.29643 WP_000036371.1.29647 WP_000036371.1.29689 WP_000036371.1.29699 WP_000036371.1.29740 WP_000036371.1.29752 WP_000036371.1.29819 WP_000036371.1.29855 WP_000036371.1.2986 WP_000036371.1.29933 WP_000036371.1.30004 WP_000036371.1.30016 WP_000036371.1.30063 WP_000036371.1.30098 WP_000036371.1.30141 WP_000036371.1.3018 WP_000036371.1.30221 WP_000036371.1.30239 WP_000036371.1.30247 WP_000036371.1.30253 WP_000036371.1.30347 WP_000036371.1.30397 WP_000036371.1.30400 WP_000036371.1.30401 WP_000036371.1.3045 WP_000036371.1.30472 WP_000036371.1.30479 WP_000036371.1.30546 WP_000036371.1.3055 WP_000036371.1.30550 WP_000036371.1.30580 WP_000036371.1.306 WP_000036371.1.3063 WP_000036371.1.30630 WP_000036371.1.30665 WP_000036371.1.30691 WP_000036371.1.30700 WP_000036371.1.30749 WP_000036371.1.30808 WP_000036371.1.30866 WP_000036371.1.30867 WP_000036371.1.30879 WP_000036371.1.309 WP_000036371.1.30960 WP_000036371.1.30987 WP_000036371.1.31017 WP_000036371.1.31026 WP_000036371.1.31083 WP_000036371.1.31149 WP_000036371.1.31188 WP_000036371.1.31353 WP_000036371.1.31421 WP_000036371.1.31422 WP_000036371.1.31431 WP_000036371.1.31433 WP_000036371.1.31434 WP_000036371.1.3147 WP_000036371.1.31482 WP_000036371.1.31506 WP_000036371.1.31511 WP_000036371.1.31527 WP_000036371.1.31542 WP_000036371.1.31557 WP_000036371.1.31625 WP_000036371.1.31639 WP_000036371.1.31679 WP_000036371.1.31681 WP_000036371.1.31696 WP_000036371.1.31736 WP_000036371.1.31740 WP_000036371.1.31801 WP_000036371.1.31809 WP_000036371.1.31825 WP_000036371.1.31898 WP_000036371.1.31899 WP_000036371.1.31903 WP_000036371.1.31928 WP_000036371.1.31937 WP_000036371.1.32021 WP_000036371.1.3203 WP_000036371.1.32049 WP_000036371.1.32078 WP_000036371.1.3212 WP_000036371.1.32143 WP_000036371.1.32173 WP_000036371.1.32242 WP_000036371.1.32279 WP_000036371.1.3233 WP_000036371.1.32333 WP_000036371.1.32394 WP_000036371.1.32432 WP_000036371.1.32435 WP_000036371.1.32478 WP_000036371.1.3248 WP_000036371.1.32480 WP_000036371.1.32518 WP_000036371.1.32558 WP_000036371.1.32580 WP_000036371.1.32587 WP_000036371.1.3259 WP_000036371.1.32635 WP_000036371.1.32676 WP_000036371.1.3269 WP_000036371.1.327 WP_000036371.1.32715 WP_000036371.1.32720 WP_000036371.1.32722 WP_000036371.1.32741 WP_000036371.1.32772 WP_000036371.1.32811 WP_000036371.1.32835 WP_000036371.1.33004 WP_000036371.1.33014 WP_000036371.1.33022 WP_000036371.1.33026 WP_000036371.1.33053 WP_000036371.1.33101 WP_000036371.1.33171 WP_000036371.1.3323 WP_000036371.1.33238 WP_000036371.1.33303 WP_000036371.1.33362 WP_000036371.1.33369 WP_000036371.1.33385 WP_000036371.1.33410 WP_000036371.1.33413 WP_000036371.1.33422 WP_000036371.1.33428 WP_000036371.1.3344 WP_000036371.1.33476 WP_000036371.1.33526 WP_000036371.1.33561 WP_000036371.1.33565 WP_000036371.1.33648 WP_000036371.1.33729 WP_000036371.1.33736 WP_000036371.1.33751 WP_000036371.1.33780 WP_000036371.1.33823 WP_000036371.1.33853 WP_000036371.1.33854 WP_000036371.1.33879 WP_000036371.1.33896 WP_000036371.1.33948 WP_000036371.1.33973 WP_000036371.1.33974 WP_000036371.1.33979 WP_000036371.1.3398 WP_000036371.1.34003 WP_000036371.1.34121 WP_000036371.1.34144 WP_000036371.1.3415 WP_000036371.1.34204 WP_000036371.1.34208 WP_000036371.1.34270 WP_000036371.1.34277 WP_000036371.1.34341 WP_000036371.1.34348 WP_000036371.1.34362 WP_000036371.1.34380 WP_000036371.1.3439 WP_000036371.1.34400 WP_000036371.1.34422 WP_000036371.1.34440 WP_000036371.1.34441 WP_000036371.1.34464 WP_000036371.1.34470 WP_000036371.1.34541 WP_000036371.1.34557 WP_000036371.1.34558 WP_000036371.1.3460 WP_000036371.1.34605 WP_000036371.1.34655 WP_000036371.1.34668 WP_000036371.1.34675 WP_000036371.1.34763 WP_000036371.1.34827 WP_000036371.1.34838 WP_000036371.1.34875 WP_000036371.1.34887 WP_000036371.1.34931 WP_000036371.1.34948 WP_000036371.1.34966 WP_000036371.1.34982 WP_000036371.1.34983 WP_000036371.1.35003 WP_000036371.1.35007 WP_000036371.1.35012 WP_000036371.1.35107 WP_000036371.1.35132 WP_000036371.1.3515 WP_000036371.1.35186 WP_000036371.1.35195 WP_000036371.1.35198 WP_000036371.1.35208 WP_000036371.1.3521 WP_000036371.1.35394 WP_000036371.1.35398 WP_000036371.1.35448 WP_000036371.1.35483 WP_000036371.1.35578 WP_000036371.1.35581 WP_000036371.1.3560 WP_000036371.1.35627 WP_000036371.1.35632 WP_000036371.1.35651 WP_000036371.1.35654 WP_000036371.1.35704 WP_000036371.1.35740 WP_000036371.1.35741 WP_000036371.1.35744 WP_000036371.1.35889 WP_000036371.1.35904 WP_000036371.1.35963 WP_000036371.1.35987 WP_000036371.1.35990 WP_000036371.1.36040 WP_000036371.1.36105 WP_000036371.1.36159 WP_000036371.1.36182 WP_000036371.1.36207 WP_000036371.1.36281 WP_000036371.1.36299 WP_000036371.1.36332 WP_000036371.1.36334 WP_000036371.1.36352 WP_000036371.1.36386 WP_000036371.1.36405 WP_000036371.1.36459 WP_000036371.1.36531 WP_000036371.1.36537 WP_000036371.1.3668 WP_000036371.1.3671 WP_000036371.1.36739 WP_000036371.1.36747 WP_000036371.1.36761 WP_000036371.1.36817 WP_000036371.1.36886 WP_000036371.1.36925 WP_000036371.1.3697 WP_000036371.1.36971 WP_000036371.1.37006 WP_000036371.1.37020 WP_000036371.1.37032 WP_000036371.1.37049 WP_000036371.1.37076 WP_000036371.1.37101 WP_000036371.1.37146 WP_000036371.1.37153 WP_000036371.1.37226 WP_000036371.1.3730 WP_000036371.1.37306 WP_000036371.1.37312 WP_000036371.1.37329 WP_000036371.1.37342 WP_000036371.1.37360 WP_000036371.1.37419 WP_000036371.1.37423 WP_000036371.1.37472 WP_000036371.1.37477 WP_000036371.1.3749 WP_000036371.1.37516 WP_000036371.1.37543 WP_000036371.1.37544 WP_000036371.1.37548 WP_000036371.1.37550 WP_000036371.1.37608 WP_000036371.1.37745 WP_000036371.1.37750 WP_000036371.1.37762 WP_000036371.1.37817 WP_000036371.1.37847 WP_000036371.1.37923 WP_000036371.1.37940 WP_000036371.1.3796 WP_000036371.1.37964 WP_000036371.1.37998 WP_000036371.1.38000 WP_000036371.1.38043 WP_000036371.1.38080 WP_000036371.1.38120 WP_000036371.1.3815 WP_000036371.1.38155 WP_000036371.1.38182 WP_000036371.1.38211 WP_000036371.1.38234 WP_000036371.1.38264 WP_000036371.1.38300 WP_000036371.1.38363 WP_000036371.1.38419 WP_000036371.1.38533 WP_000036371.1.38544 WP_000036371.1.38561 WP_000036371.1.38584 WP_000036371.1.38610 WP_000036371.1.38751 WP_000036371.1.38777 WP_000036371.1.38782 WP_000036371.1.38827 WP_000036371.1.39015 WP_000036371.1.3903 WP_000036371.1.39111 WP_000036371.1.39148 WP_000036371.1.39155 WP_000036371.1.39157 WP_000036371.1.39167 WP_000036371.1.39184 WP_000036371.1.39196 WP_000036371.1.3921 WP_000036371.1.3922 WP_000036371.1.39232 WP_000036371.1.39249 WP_000036371.1.39254 WP_000036371.1.39289 WP_000036371.1.39313 WP_000036371.1.39342 WP_000036371.1.39373 WP_000036371.1.39377 WP_000036371.1.39401 WP_000036371.1.39430 WP_000036371.1.39468 WP_000036371.1.39492 WP_000036371.1.39541 WP_000036371.1.39575 WP_000036371.1.39580 WP_000036371.1.39651 WP_000036371.1.39708 WP_000036371.1.39713 WP_000036371.1.39715 WP_000036371.1.39726 WP_000036371.1.39730 WP_000036371.1.39734 WP_000036371.1.39796 WP_000036371.1.3980 WP_000036371.1.39809 WP_000036371.1.39867 WP_000036371.1.39961 WP_000036371.1.39966 WP_000036371.1.39970 WP_000036371.1.39998 WP_000036371.1.40 WP_000036371.1.40016 WP_000036371.1.4005 WP_000036371.1.40083 WP_000036371.1.40107 WP_000036371.1.40121 WP_000036371.1.40140 WP_000036371.1.40147 WP_000036371.1.40153 WP_000036371.1.40159 WP_000036371.1.40183 WP_000036371.1.40212 WP_000036371.1.40218 WP_000036371.1.40238 WP_000036371.1.40300 WP_000036371.1.40319 WP_000036371.1.40345 WP_000036371.1.40349 WP_000036371.1.40360 WP_000036371.1.40486 WP_000036371.1.40560 WP_000036371.1.40596 WP_000036371.1.40623 WP_000036371.1.40636 WP_000036371.1.40657 WP_000036371.1.40660 WP_000036371.1.40666 WP_000036371.1.40668 WP_000036371.1.40712 WP_000036371.1.40715 WP_000036371.1.4081 WP_000036371.1.40833 WP_000036371.1.40843 WP_000036371.1.40893 WP_000036371.1.41041 WP_000036371.1.41063 WP_000036371.1.41078 WP_000036371.1.41230 WP_000036371.1.41239 WP_000036371.1.41259 WP_000036371.1.41332 WP_000036371.1.41394 WP_000036371.1.41401 WP_000036371.1.41417 WP_000036371.1.41453 WP_000036371.1.41457 WP_000036371.1.41479 WP_000036371.1.41482 WP_000036371.1.41483 WP_000036371.1.41488 WP_000036371.1.41530 WP_000036371.1.41606 WP_000036371.1.41651 WP_000036371.1.41718 WP_000036371.1.41778 WP_000036371.1.41809 WP_000036371.1.41812 WP_000036371.1.41822 WP_000036371.1.41826 WP_000036371.1.41837 WP_000036371.1.41884 WP_000036371.1.4193 WP_000036371.1.41956 WP_000036371.1.41960 WP_000036371.1.41964 WP_000036371.1.41990 WP_000036371.1.41991 WP_000036371.1.42073 WP_000036371.1.42095 WP_000036371.1.42096 WP_000036371.1.42113 WP_000036371.1.4214 WP_000036371.1.42151 WP_000036371.1.42159 WP_000036371.1.42179 WP_000036371.1.42191 WP_000036371.1.42214 WP_000036371.1.42221 WP_000036371.1.42258 WP_000036371.1.42277 WP_000036371.1.42284 WP_000036371.1.42300 WP_000036371.1.42318 WP_000036371.1.42359 WP_000036371.1.42369 WP_000036371.1.42443 WP_000036371.1.42456 WP_000036371.1.42547 WP_000036371.1.42600 WP_000036371.1.42601 WP_000036371.1.42638 WP_000036371.1.42677 WP_000036371.1.42728 WP_000036371.1.42750 WP_000036371.1.42761 WP_000036371.1.42771 WP_000036371.1.42791 WP_000036371.1.42808 WP_000036371.1.42828 WP_000036371.1.42830 WP_000036371.1.42879 WP_000036371.1.4290 WP_000036371.1.42918 WP_000036371.1.42936 WP_000036371.1.42966 WP_000036371.1.42989 WP_000036371.1.4306 WP_000036371.1.43123 WP_000036371.1.43174 WP_000036371.1.43216 WP_000036371.1.43278 WP_000036371.1.43324 WP_000036371.1.4334 WP_000036371.1.43374 WP_000036371.1.43427 WP_000036371.1.4343 WP_000036371.1.43566 WP_000036371.1.43598 WP_000036371.1.43622 WP_000036371.1.43769 WP_000036371.1.43804 WP_000036371.1.43898 WP_000036371.1.43918 WP_000036371.1.43942 WP_000036371.1.43966 WP_000036371.1.43989 WP_000036371.1.4400 WP_000036371.1.44020 WP_000036371.1.44075 WP_000036371.1.4411 WP_000036371.1.44130 WP_000036371.1.44211 WP_000036371.1.44263 WP_000036371.1.44287 WP_000036371.1.44314 WP_000036371.1.44324 WP_000036371.1.44327 WP_000036371.1.44394 WP_000036371.1.44422 WP_000036371.1.44424 WP_000036371.1.44426 WP_000036371.1.44447 WP_000036371.1.44539 WP_000036371.1.4454 WP_000036371.1.4459 WP_000036371.1.44610 WP_000036371.1.4463 WP_000036371.1.44642 WP_000036371.1.44686 WP_000036371.1.4471 WP_000036371.1.44717 WP_000036371.1.448 WP_000036371.1.44814 WP_000036371.1.44818 WP_000036371.1.44841 WP_000036371.1.44848 WP_000036371.1.44980 WP_000036371.1.45025 WP_000036371.1.45028 WP_000036371.1.45068 WP_000036371.1.45104 WP_000036371.1.45156 WP_000036371.1.45190 WP_000036371.1.4524 WP_000036371.1.4530 WP_000036371.1.45313 WP_000036371.1.4538 WP_000036371.1.45405 WP_000036371.1.45440 WP_000036371.1.45486 WP_000036371.1.45494 WP_000036371.1.45500 WP_000036371.1.45525 WP_000036371.1.45627 WP_000036371.1.4563 WP_000036371.1.45664 WP_000036371.1.45674 WP_000036371.1.45676 WP_000036371.1.45740 WP_000036371.1.45741 WP_000036371.1.45752 WP_000036371.1.45789 WP_000036371.1.45793 WP_000036371.1.45801 WP_000036371.1.45806 WP_000036371.1.4583 WP_000036371.1.45891 WP_000036371.1.4593 WP_000036371.1.45962 WP_000036371.1.45968 WP_000036371.1.45991 WP_000036371.1.46026 WP_000036371.1.46115 WP_000036371.1.46164 WP_000036371.1.4617 WP_000036371.1.46245 WP_000036371.1.46291 WP_000036371.1.4643 WP_000036371.1.46438 WP_000036371.1.46468 WP_000036371.1.46531 WP_000036371.1.46541 WP_000036371.1.46573 WP_000036371.1.46589 WP_000036371.1.46594 WP_000036371.1.46643 WP_000036371.1.46655 WP_000036371.1.4670 WP_000036371.1.46795 WP_000036371.1.46806 WP_000036371.1.46857 WP_000036371.1.4695 WP_000036371.1.47030 WP_000036371.1.47047 WP_000036371.1.47063 WP_000036371.1.47073 WP_000036371.1.47135 WP_000036371.1.47167 WP_000036371.1.47186 WP_000036371.1.47189 WP_000036371.1.47197 WP_000036371.1.4722 WP_000036371.1.47224 WP_000036371.1.47235 WP_000036371.1.4725 WP_000036371.1.47316 WP_000036371.1.47322 WP_000036371.1.47344 WP_000036371.1.47349 WP_000036371.1.47350 WP_000036371.1.47366 WP_000036371.1.47386 WP_000036371.1.47416 WP_000036371.1.47425 WP_000036371.1.47451 WP_000036371.1.47454 WP_000036371.1.47533 WP_000036371.1.47546 WP_000036371.1.47582 WP_000036371.1.47646 WP_000036371.1.47654 WP_000036371.1.47722 WP_000036371.1.4773 WP_000036371.1.47740 WP_000036371.1.47761 WP_000036371.1.47764 WP_000036371.1.4783 WP_000036371.1.47914 WP_000036371.1.47935 WP_000036371.1.4796 WP_000036371.1.47981 WP_000036371.1.48029 WP_000036371.1.48040 WP_000036371.1.48048 WP_000036371.1.48051 WP_000036371.1.48073 WP_000036371.1.48080 WP_000036371.1.48087 WP_000036371.1.48090 WP_000036371.1.4811 WP_000036371.1.48168 WP_000036371.1.48194 WP_000036371.1.48203 WP_000036371.1.4826 WP_000036371.1.48317 WP_000036371.1.48353 WP_000036371.1.48371 WP_000036371.1.48404 WP_000036371.1.48417 WP_000036371.1.48431 WP_000036371.1.48469 WP_000036371.1.48477 WP_000036371.1.48505 WP_000036371.1.48590 WP_000036371.1.48602 WP_000036371.1.48626 WP_000036371.1.48689 WP_000036371.1.4871 WP_000036371.1.48808 WP_000036371.1.48825 WP_000036371.1.48827 WP_000036371.1.48847 WP_000036371.1.48970 WP_000036371.1.49136 WP_000036371.1.49170 WP_000036371.1.49179 WP_000036371.1.49236 WP_000036371.1.49258 WP_000036371.1.49259 WP_000036371.1.49275 WP_000036371.1.49321 WP_000036371.1.49347 WP_000036371.1.49431 WP_000036371.1.49483 WP_000036371.1.49521 WP_000036371.1.49528 WP_000036371.1.49594 WP_000036371.1.49615 WP_000036371.1.49621 WP_000036371.1.49625 WP_000036371.1.49661 WP_000036371.1.49684 WP_000036371.1.497 WP_000036371.1.49733 WP_000036371.1.49740 WP_000036371.1.49768 WP_000036371.1.49777 WP_000036371.1.49783 WP_000036371.1.49788 WP_000036371.1.49883 WP_000036371.1.49884 WP_000036371.1.49902 WP_000036371.1.49972 WP_000036371.1.50058 WP_000036371.1.50098 WP_000036371.1.50136 WP_000036371.1.5017 WP_000036371.1.50187 WP_000036371.1.50196 WP_000036371.1.50228 WP_000036371.1.50230 WP_000036371.1.50262 WP_000036371.1.50266 WP_000036371.1.50273 WP_000036371.1.50329 WP_000036371.1.50381 WP_000036371.1.5040 WP_000036371.1.5041 WP_000036371.1.5046 WP_000036371.1.50539 WP_000036371.1.50548 WP_000036371.1.5056 WP_000036371.1.50564 WP_000036371.1.50579 WP_000036371.1.50585 WP_000036371.1.506 WP_000036371.1.50608 WP_000036371.1.5061 WP_000036371.1.50690 WP_000036371.1.50717 WP_000036371.1.50925 WP_000036371.1.50936 WP_000036371.1.50947 WP_000036371.1.5095 WP_000036371.1.50957 WP_000036371.1.50988 WP_000036371.1.50990 WP_000036371.1.50993 WP_000036371.1.51027 WP_000036371.1.511 WP_000036371.1.51127 WP_000036371.1.51170 WP_000036371.1.51180 WP_000036371.1.51190 WP_000036371.1.51201 WP_000036371.1.51211 WP_000036371.1.5124 WP_000036371.1.51253 WP_000036371.1.51255 WP_000036371.1.51283 WP_000036371.1.51300 WP_000036371.1.51320 WP_000036371.1.51325 WP_000036371.1.51336 WP_000036371.1.51354 WP_000036371.1.51360 WP_000036371.1.51364 WP_000036371.1.51392 WP_000036371.1.51425 WP_000036371.1.51426 WP_000036371.1.5146 WP_000036371.1.51482 WP_000036371.1.51503 WP_000036371.1.51513 WP_000036371.1.51542 WP_000036371.1.5158 WP_000036371.1.51580 WP_000036371.1.51596 WP_000036371.1.51624 WP_000036371.1.51662 WP_000036371.1.51869 WP_000036371.1.51906 WP_000036371.1.51968 WP_000036371.1.51979 WP_000036371.1.52011 WP_000036371.1.52044 WP_000036371.1.52048 WP_000036371.1.52062 WP_000036371.1.52085 WP_000036371.1.52111 WP_000036371.1.52126 WP_000036371.1.52135 WP_000036371.1.52137 WP_000036371.1.52213 WP_000036371.1.52225 WP_000036371.1.52230 WP_000036371.1.52236 WP_000036371.1.52240 WP_000036371.1.52249 WP_000036371.1.52257 WP_000036371.1.52304 WP_000036371.1.52313 WP_000036371.1.52324 WP_000036371.1.52328 WP_000036371.1.52399 WP_000036371.1.52413 WP_000036371.1.52421 WP_000036371.1.52492 WP_000036371.1.52544 WP_000036371.1.52554 WP_000036371.1.52567 WP_000036371.1.52601 WP_000036371.1.5265 WP_000036371.1.5272 WP_000036371.1.52755 WP_000036371.1.52771 WP_000036371.1.52781 WP_000036371.1.52852 WP_000036371.1.52853 WP_000036371.1.52855 WP_000036371.1.52942 WP_000036371.1.52945 WP_000036371.1.52996 WP_000036371.1.53021 WP_000036371.1.53095 WP_000036371.1.53099 WP_000036371.1.53110 WP_000036371.1.53123 WP_000036371.1.53186 WP_000036371.1.5322 WP_000036371.1.53244 WP_000036371.1.53277 WP_000036371.1.53308 WP_000036371.1.53419 WP_000036371.1.53428 WP_000036371.1.53482 WP_000036371.1.53505 WP_000036371.1.5351 WP_000036371.1.53535 WP_000036371.1.53556 WP_000036371.1.53557 WP_000036371.1.53574 WP_000036371.1.53582 WP_000036371.1.53589 WP_000036371.1.53592 WP_000036371.1.53594 WP_000036371.1.53687 WP_000036371.1.53811 WP_000036371.1.53841 WP_000036371.1.53878 WP_000036371.1.53884 WP_000036371.1.5391 WP_000036371.1.53940 WP_000036371.1.5395 WP_000036371.1.53968 WP_000036371.1.53991 WP_000036371.1.54095 WP_000036371.1.54185 WP_000036371.1.54188 WP_000036371.1.54208 WP_000036371.1.54313 WP_000036371.1.54328 WP_000036371.1.5433 WP_000036371.1.5434 WP_000036371.1.54344 WP_000036371.1.5440 WP_000036371.1.54411 WP_000036371.1.54418 WP_000036371.1.54439 WP_000036371.1.54476 WP_000036371.1.54507 WP_000036371.1.54590 WP_000036371.1.5460 WP_000036371.1.54601 WP_000036371.1.5461 WP_000036371.1.54614 WP_000036371.1.54625 WP_000036371.1.54641 WP_000036371.1.54643 WP_000036371.1.54754 WP_000036371.1.54760 WP_000036371.1.54769 WP_000036371.1.5478 WP_000036371.1.54921 WP_000036371.1.54941 WP_000036371.1.54946 WP_000036371.1.54972 WP_000036371.1.54981 WP_000036371.1.54993 WP_000036371.1.55149 WP_000036371.1.55177 WP_000036371.1.55226 WP_000036371.1.55275 WP_000036371.1.55291 WP_000036371.1.55359 WP_000036371.1.55424 WP_000036371.1.55482 WP_000036371.1.55483 WP_000036371.1.55489 WP_000036371.1.55507 WP_000036371.1.55551 WP_000036371.1.5566 WP_000036371.1.55727 WP_000036371.1.55731 WP_000036371.1.55790 WP_000036371.1.55791 WP_000036371.1.55808 WP_000036371.1.55896 WP_000036371.1.55979 WP_000036371.1.55981 WP_000036371.1.56033 WP_000036371.1.56040 WP_000036371.1.56047 WP_000036371.1.561 WP_000036371.1.56101 WP_000036371.1.56122 WP_000036371.1.56139 WP_000036371.1.56142 WP_000036371.1.562 WP_000036371.1.56278 WP_000036371.1.56285 WP_000036371.1.56293 WP_000036371.1.5632 WP_000036371.1.56338 WP_000036371.1.56345 WP_000036371.1.56388 WP_000036371.1.56402 WP_000036371.1.56436 WP_000036371.1.56446 WP_000036371.1.56457 WP_000036371.1.5649 WP_000036371.1.56502 WP_000036371.1.56513 WP_000036371.1.56528 WP_000036371.1.56573 WP_000036371.1.56776 WP_000036371.1.56777 WP_000036371.1.56787 WP_000036371.1.56799 WP_000036371.1.56821 WP_000036371.1.56830 WP_000036371.1.56908 WP_000036371.1.56932 WP_000036371.1.56933 WP_000036371.1.56936 WP_000036371.1.56937 WP_000036371.1.56941 WP_000036371.1.56951 WP_000036371.1.56980 WP_000036371.1.56992 WP_000036371.1.57011 WP_000036371.1.57045 WP_000036371.1.57051 WP_000036371.1.57124 WP_000036371.1.57182 WP_000036371.1.57254 WP_000036371.1.57266 WP_000036371.1.57269 WP_000036371.1.57319 WP_000036371.1.57401 WP_000036371.1.57451 WP_000036371.1.57492 WP_000036371.1.57517 WP_000036371.1.57550 WP_000036371.1.57574 WP_000036371.1.57608 WP_000036371.1.57628 WP_000036371.1.57634 WP_000036371.1.57663 WP_000036371.1.57719 WP_000036371.1.57832 WP_000036371.1.5786 WP_000036371.1.5787 WP_000036371.1.57898 WP_000036371.1.57903 WP_000036371.1.57904 WP_000036371.1.57951 WP_000036371.1.57975 WP_000036371.1.57982 WP_000036371.1.57983 WP_000036371.1.57994 WP_000036371.1.58045 WP_000036371.1.58092 WP_000036371.1.58094 WP_000036371.1.58098 WP_000036371.1.5810 WP_000036371.1.58233 WP_000036371.1.58244 WP_000036371.1.58248 WP_000036371.1.58336 WP_000036371.1.58340 WP_000036371.1.58345 WP_000036371.1.58368 WP_000036371.1.58384 WP_000036371.1.58408 WP_000036371.1.58475 WP_000036371.1.58484 WP_000036371.1.58493 WP_000036371.1.58496 WP_000036371.1.585 WP_000036371.1.58552 WP_000036371.1.58560 WP_000036371.1.58609 WP_000036371.1.58680 WP_000036371.1.58692 WP_000036371.1.58799 WP_000036371.1.58867 WP_000036371.1.58901 WP_000036371.1.58942 WP_000036371.1.58999 WP_000036371.1.59024 WP_000036371.1.59035 WP_000036371.1.59060 WP_000036371.1.59073 WP_000036371.1.59174 WP_000036371.1.59218 WP_000036371.1.59263 WP_000036371.1.59395 WP_000036371.1.5942 WP_000036371.1.59426 WP_000036371.1.59483 WP_000036371.1.59513 WP_000036371.1.59533 WP_000036371.1.59572 WP_000036371.1.59577 WP_000036371.1.5963 WP_000036371.1.59660 WP_000036371.1.59689 WP_000036371.1.597 WP_000036371.1.59730 WP_000036371.1.59745 WP_000036371.1.59748 WP_000036371.1.59756 WP_000036371.1.59793 WP_000036371.1.59815 WP_000036371.1.59823 WP_000036371.1.59853 WP_000036371.1.59855 WP_000036371.1.59858 WP_000036371.1.5990 WP_000036371.1.59900 WP_000036371.1.59912 WP_000036371.1.59914 WP_000036371.1.59970 WP_000036371.1.60005 WP_000036371.1.60023 WP_000036371.1.60031 WP_000036371.1.60048 WP_000036371.1.60096 WP_000036371.1.60110 WP_000036371.1.60133 WP_000036371.1.60151 WP_000036371.1.60186 WP_000036371.1.60225 WP_000036371.1.60228 WP_000036371.1.60235 WP_000036371.1.60246 WP_000036371.1.60337 WP_000036371.1.60343 WP_000036371.1.60373 WP_000036371.1.60411 WP_000036371.1.60436 WP_000036371.1.60443 WP_000036371.1.60477 WP_000036371.1.60550 WP_000036371.1.60559 WP_000036371.1.60567 WP_000036371.1.60570 WP_000036371.1.60576 WP_000036371.1.60599 WP_000036371.1.6061 WP_000036371.1.60614 WP_000036371.1.60644 WP_000036371.1.60671 WP_000036371.1.6068 WP_000036371.1.60684 WP_000036371.1.60771 WP_000036371.1.60816 WP_000036371.1.60826 WP_000036371.1.60847 WP_000036371.1.60895 WP_000036371.1.60921 WP_000036371.1.60925 WP_000036371.1.60927 WP_000036371.1.6094 WP_000036371.1.60974 WP_000036371.1.61005 WP_000036371.1.61006 WP_000036371.1.61046 WP_000036371.1.6106 WP_000036371.1.61097 WP_000036371.1.61102 WP_000036371.1.61132 WP_000036371.1.61148 WP_000036371.1.61170 WP_000036371.1.61175 WP_000036371.1.61181 WP_000036371.1.61183 WP_000036371.1.61223 WP_000036371.1.61245 WP_000036371.1.61268 WP_000036371.1.61284 WP_000036371.1.61360 WP_000036371.1.61362 WP_000036371.1.61373 WP_000036371.1.61445 WP_000036371.1.61496 WP_000036371.1.615 WP_000036371.1.61505 WP_000036371.1.61517 WP_000036371.1.61524 WP_000036371.1.61608 WP_000036371.1.61612 WP_000036371.1.61617 WP_000036371.1.61643 WP_000036371.1.61703 WP_000036371.1.61718 WP_000036371.1.61770 WP_000036371.1.61822 WP_000036371.1.61853 WP_000036371.1.61893 WP_000036371.1.61966 WP_000036371.1.61985 WP_000036371.1.62043 WP_000036371.1.62091 WP_000036371.1.62099 WP_000036371.1.62102 WP_000036371.1.62296 WP_000036371.1.62303 WP_000036371.1.62322 WP_000036371.1.62348 WP_000036371.1.62424 WP_000036371.1.6245 WP_000036371.1.62454 WP_000036371.1.62460 WP_000036371.1.62481 WP_000036371.1.62507 WP_000036371.1.62513 WP_000036371.1.62541 WP_000036371.1.62555 WP_000036371.1.62586 WP_000036371.1.62612 WP_000036371.1.62631 WP_000036371.1.62668 WP_000036371.1.62787 WP_000036371.1.62788 WP_000036371.1.62802 WP_000036371.1.62919 WP_000036371.1.6293 WP_000036371.1.62992 WP_000036371.1.63023 WP_000036371.1.63078 WP_000036371.1.63113 WP_000036371.1.63189 WP_000036371.1.63287 WP_000036371.1.63305 WP_000036371.1.63310 WP_000036371.1.63330 WP_000036371.1.6334 WP_000036371.1.6337 WP_000036371.1.63419 WP_000036371.1.63433 WP_000036371.1.63435 WP_000036371.1.63465 WP_000036371.1.6348 WP_000036371.1.63491 WP_000036371.1.63602 WP_000036371.1.63604 WP_000036371.1.63608 WP_000036371.1.63683 WP_000036371.1.63703 WP_000036371.1.63721 WP_000036371.1.63800 WP_000036371.1.63810 WP_000036371.1.63871 WP_000036371.1.63964 WP_000036371.1.63969 WP_000036371.1.63990 WP_000036371.1.64008 WP_000036371.1.64053 WP_000036371.1.64110 WP_000036371.1.64138 WP_000036371.1.64180 WP_000036371.1.64280 WP_000036371.1.643 WP_000036371.1.6431 WP_000036371.1.64321 WP_000036371.1.64330 WP_000036371.1.64337 WP_000036371.1.64353 WP_000036371.1.64417 WP_000036371.1.64437 WP_000036371.1.64540 WP_000036371.1.64547 WP_000036371.1.64563 WP_000036371.1.64634 WP_000036371.1.6469 WP_000036371.1.64746 WP_000036371.1.64784 WP_000036371.1.64821 WP_000036371.1.64866 WP_000036371.1.64895 WP_000036371.1.64901 WP_000036371.1.64912 WP_000036371.1.64926 WP_000036371.1.64939 WP_000036371.1.6499 WP_000036371.1.64990 WP_000036371.1.6500 WP_000036371.1.651 WP_000036371.1.65104 WP_000036371.1.65110 WP_000036371.1.65114 WP_000036371.1.65135 WP_000036371.1.65151 WP_000036371.1.6516 WP_000036371.1.65192 WP_000036371.1.65206 WP_000036371.1.65256 WP_000036371.1.6527 WP_000036371.1.65286 WP_000036371.1.65353 WP_000036371.1.65366 WP_000036371.1.6537 WP_000036371.1.6553 WP_000036371.1.65596 WP_000036371.1.65606 WP_000036371.1.65667 WP_000036371.1.65672 WP_000036371.1.65677 WP_000036371.1.65714 WP_000036371.1.65954 WP_000036371.1.65957 WP_000036371.1.65976 WP_000036371.1.66016 WP_000036371.1.66017 WP_000036371.1.66044 WP_000036371.1.66050 WP_000036371.1.66102 WP_000036371.1.66105 WP_000036371.1.66127 WP_000036371.1.66161 WP_000036371.1.6618 WP_000036371.1.6622 WP_000036371.1.66264 WP_000036371.1.66280 WP_000036371.1.66290 WP_000036371.1.66335 WP_000036371.1.6635 WP_000036371.1.66376 WP_000036371.1.66389 WP_000036371.1.66432 WP_000036371.1.66448 WP_000036371.1.66501 WP_000036371.1.6666 WP_000036371.1.66706 WP_000036371.1.66751 WP_000036371.1.66783 WP_000036371.1.66791 WP_000036371.1.66794 WP_000036371.1.66795 WP_000036371.1.66796 WP_000036371.1.66975 WP_000036371.1.6698 WP_000036371.1.67021 WP_000036371.1.67035 WP_000036371.1.67047 WP_000036371.1.6706 WP_000036371.1.67120 WP_000036371.1.67132 WP_000036371.1.67149 WP_000036371.1.67153 WP_000036371.1.67164 WP_000036371.1.67174 WP_000036371.1.67193 WP_000036371.1.67200 WP_000036371.1.67258 WP_000036371.1.67272 WP_000036371.1.67427 WP_000036371.1.67451 WP_000036371.1.67456 WP_000036371.1.67462 WP_000036371.1.67464 WP_000036371.1.67467 WP_000036371.1.67549 WP_000036371.1.67606 WP_000036371.1.67660 WP_000036371.1.67704 WP_000036371.1.67737 WP_000036371.1.67787 WP_000036371.1.67901 WP_000036371.1.6793 WP_000036371.1.67938 WP_000036371.1.67971 WP_000036371.1.67984 WP_000036371.1.67990 WP_000036371.1.68012 WP_000036371.1.68052 WP_000036371.1.68053 WP_000036371.1.68063 WP_000036371.1.68069 WP_000036371.1.68070 WP_000036371.1.68071 WP_000036371.1.6810 WP_000036371.1.68108 WP_000036371.1.68126 WP_000036371.1.68138 WP_000036371.1.68145 WP_000036371.1.68177 WP_000036371.1.68200 WP_000036371.1.68281 WP_000036371.1.68283 WP_000036371.1.68362 WP_000036371.1.68369 WP_000036371.1.68395 WP_000036371.1.68396 WP_000036371.1.68482 WP_000036371.1.68490 WP_000036371.1.68524 WP_000036371.1.68572 WP_000036371.1.68584 WP_000036371.1.68598 WP_000036371.1.68630 WP_000036371.1.68635 WP_000036371.1.68679 WP_000036371.1.68701 WP_000036371.1.68750 WP_000036371.1.68752 WP_000036371.1.6877 WP_000036371.1.68795 WP_000036371.1.68847 WP_000036371.1.68880 WP_000036371.1.68924 WP_000036371.1.68952 WP_000036371.1.68961 WP_000036371.1.68995 WP_000036371.1.69033 WP_000036371.1.69039 WP_000036371.1.6919 WP_000036371.1.69192 WP_000036371.1.6921 WP_000036371.1.69221 WP_000036371.1.6923 WP_000036371.1.6929 WP_000036371.1.69382 WP_000036371.1.694 WP_000036371.1.69441 WP_000036371.1.6945 WP_000036371.1.69450 WP_000036371.1.69537 WP_000036371.1.69569 WP_000036371.1.69583 WP_000036371.1.69596 WP_000036371.1.69605 WP_000036371.1.69643 WP_000036371.1.69646 WP_000036371.1.69655 WP_000036371.1.697 WP_000036371.1.69716 WP_000036371.1.69730 WP_000036371.1.69735 WP_000036371.1.69831 WP_000036371.1.69832 WP_000036371.1.69872 WP_000036371.1.6993 WP_000036371.1.69963 WP_000036371.1.69979 WP_000036371.1.7001 WP_000036371.1.70041 WP_000036371.1.70081 WP_000036371.1.701 WP_000036371.1.7013 WP_000036371.1.7015 WP_000036371.1.70190 WP_000036371.1.70200 WP_000036371.1.70230 WP_000036371.1.70370 WP_000036371.1.70407 WP_000036371.1.70492 WP_000036371.1.7050 WP_000036371.1.70509 WP_000036371.1.70530 WP_000036371.1.70597 WP_000036371.1.70600 WP_000036371.1.70619 WP_000036371.1.70656 WP_000036371.1.70698 WP_000036371.1.70705 WP_000036371.1.70728 WP_000036371.1.70747 WP_000036371.1.70767 WP_000036371.1.70900 WP_000036371.1.7102 WP_000036371.1.71037 WP_000036371.1.71139 WP_000036371.1.71144 WP_000036371.1.71159 WP_000036371.1.71170 WP_000036371.1.71176 WP_000036371.1.71192 WP_000036371.1.71223 WP_000036371.1.71229 WP_000036371.1.71264 WP_000036371.1.71273 WP_000036371.1.71285 WP_000036371.1.71287 WP_000036371.1.71294 WP_000036371.1.71311 WP_000036371.1.71312 WP_000036371.1.71323 WP_000036371.1.71421 WP_000036371.1.7147 WP_000036371.1.71480 WP_000036371.1.71540 WP_000036371.1.71560 WP_000036371.1.71563 WP_000036371.1.71603 WP_000036371.1.71632 WP_000036371.1.71695 WP_000036371.1.71732 WP_000036371.1.71855 WP_000036371.1.71922 WP_000036371.1.71939 WP_000036371.1.71945 WP_000036371.1.71967 WP_000036371.1.71993 WP_000036371.1.71995 WP_000036371.1.72028 WP_000036371.1.72053 WP_000036371.1.72054 WP_000036371.1.72090 WP_000036371.1.72117 WP_000036371.1.72120 WP_000036371.1.72126 WP_000036371.1.72153 WP_000036371.1.72161 WP_000036371.1.72184 WP_000036371.1.72208 WP_000036371.1.72212 WP_000036371.1.72237 WP_000036371.1.72248 WP_000036371.1.7225 WP_000036371.1.72262 WP_000036371.1.72290 WP_000036371.1.72293 WP_000036371.1.72298 WP_000036371.1.723 WP_000036371.1.72352 WP_000036371.1.72359 WP_000036371.1.72362 WP_000036371.1.72388 WP_000036371.1.72391 WP_000036371.1.72392 WP_000036371.1.72425 WP_000036371.1.72522 WP_000036371.1.72544 WP_000036371.1.72574 WP_000036371.1.72593 WP_000036371.1.72599 WP_000036371.1.72651 WP_000036371.1.72663 WP_000036371.1.72700 WP_000036371.1.72738 WP_000036371.1.72745 WP_000036371.1.72747 WP_000036371.1.72778 WP_000036371.1.72804 WP_000036371.1.72806 WP_000036371.1.7281 WP_000036371.1.72857 WP_000036371.1.72860 WP_000036371.1.72893 WP_000036371.1.72947 WP_000036371.1.72956 WP_000036371.1.72998 WP_000036371.1.73015 WP_000036371.1.73061 WP_000036371.1.7307 WP_000036371.1.73193 WP_000036371.1.73215 WP_000036371.1.73230 WP_000036371.1.73243 WP_000036371.1.73259 WP_000036371.1.73278 WP_000036371.1.73283 WP_000036371.1.73291 WP_000036371.1.73292 WP_000036371.1.73333 WP_000036371.1.73340 WP_000036371.1.73344 WP_000036371.1.73486 WP_000036371.1.73498 WP_000036371.1.73524 WP_000036371.1.73592 WP_000036371.1.73631 WP_000036371.1.73652 WP_000036371.1.7376 WP_000036371.1.73811 WP_000036371.1.73844 WP_000036371.1.73846 WP_000036371.1.73980 WP_000036371.1.73992 WP_000036371.1.74032 WP_000036371.1.74041 WP_000036371.1.74045 WP_000036371.1.74053 WP_000036371.1.7411 WP_000036371.1.74213 WP_000036371.1.74223 WP_000036371.1.7424 WP_000036371.1.74243 WP_000036371.1.74267 WP_000036371.1.74294 WP_000036371.1.74367 WP_000036371.1.74445 WP_000036371.1.74465 WP_000036371.1.74574 WP_000036371.1.74631 WP_000036371.1.7471 WP_000036371.1.74713 WP_000036371.1.74716 WP_000036371.1.74720 WP_000036371.1.7475 WP_000036371.1.74765 WP_000036371.1.7479 WP_000036371.1.74854 WP_000036371.1.74860 WP_000036371.1.74867 WP_000036371.1.74873 WP_000036371.1.74879 WP_000036371.1.74880 WP_000036371.1.74914 WP_000036371.1.74915 WP_000036371.1.74975 WP_000036371.1.74993 WP_000036371.1.75003 WP_000036371.1.75118 WP_000036371.1.75138 WP_000036371.1.75139 WP_000036371.1.75143 WP_000036371.1.75155 WP_000036371.1.75218 WP_000036371.1.75219 WP_000036371.1.75221 WP_000036371.1.75228 WP_000036371.1.75243 WP_000036371.1.75247 WP_000036371.1.75306 WP_000036371.1.75367 WP_000036371.1.75419 WP_000036371.1.75428 WP_000036371.1.75491 WP_000036371.1.75557 WP_000036371.1.75568 WP_000036371.1.75594 WP_000036371.1.75602 WP_000036371.1.75653 WP_000036371.1.75698 WP_000036371.1.75699 WP_000036371.1.75725 WP_000036371.1.75735 WP_000036371.1.75803 WP_000036371.1.75839 WP_000036371.1.75853 WP_000036371.1.7597 WP_000036371.1.76005 WP_000036371.1.76019 WP_000036371.1.76030 WP_000036371.1.76089 WP_000036371.1.76118 WP_000036371.1.76119 WP_000036371.1.7613 WP_000036371.1.76184 WP_000036371.1.76196 WP_000036371.1.76211 WP_000036371.1.76237 WP_000036371.1.76268 WP_000036371.1.76269 WP_000036371.1.7637 WP_000036371.1.76376 WP_000036371.1.76390 WP_000036371.1.76446 WP_000036371.1.76452 WP_000036371.1.76462 WP_000036371.1.76466 WP_000036371.1.76469 WP_000036371.1.76504 WP_000036371.1.76544 WP_000036371.1.76562 WP_000036371.1.76612 WP_000036371.1.76643 WP_000036371.1.76660 WP_000036371.1.76705 WP_000036371.1.76759 WP_000036371.1.7680 WP_000036371.1.76831 WP_000036371.1.76884 WP_000036371.1.7689 WP_000036371.1.76918 WP_000036371.1.76933 WP_000036371.1.76961 WP_000036371.1.76994 WP_000036371.1.77036 WP_000036371.1.771 WP_000036371.1.77120 WP_000036371.1.77173 WP_000036371.1.77175 WP_000036371.1.77200 WP_000036371.1.77214 WP_000036371.1.77224 WP_000036371.1.77288 WP_000036371.1.7729 WP_000036371.1.77290 WP_000036371.1.77296 WP_000036371.1.77326 WP_000036371.1.77391 WP_000036371.1.77419 WP_000036371.1.77448 WP_000036371.1.77452 WP_000036371.1.77481 WP_000036371.1.775 WP_000036371.1.7750 WP_000036371.1.77542 WP_000036371.1.77577 WP_000036371.1.77600 WP_000036371.1.77632 WP_000036371.1.77643 WP_000036371.1.77648 WP_000036371.1.77657 WP_000036371.1.77725 WP_000036371.1.7775 WP_000036371.1.77768 WP_000036371.1.7780 WP_000036371.1.77816 WP_000036371.1.77949 WP_000036371.1.7795 WP_000036371.1.77950 WP_000036371.1.78007 WP_000036371.1.78010 WP_000036371.1.78059 WP_000036371.1.7806 WP_000036371.1.7808 WP_000036371.1.78097 WP_000036371.1.78101 WP_000036371.1.78131 WP_000036371.1.78188 WP_000036371.1.78202 WP_000036371.1.78232 WP_000036371.1.78235 WP_000036371.1.78305 WP_000036371.1.78340 WP_000036371.1.78390 WP_000036371.1.78413 WP_000036371.1.78453 WP_000036371.1.78462 WP_000036371.1.7847 WP_000036371.1.78477 WP_000036371.1.78481 WP_000036371.1.78491 WP_000036371.1.7851 WP_000036371.1.78512 WP_000036371.1.78527 WP_000036371.1.78553 WP_000036371.1.78575 WP_000036371.1.78615 WP_000036371.1.78645 WP_000036371.1.78689 WP_000036371.1.78696 WP_000036371.1.78706 WP_000036371.1.78746 WP_000036371.1.78791 WP_000036371.1.78814 WP_000036371.1.78845 WP_000036371.1.78996 WP_000036371.1.79001 WP_000036371.1.79002 WP_000036371.1.79088 WP_000036371.1.79090 WP_000036371.1.79092 WP_000036371.1.79100 WP_000036371.1.79126 WP_000036371.1.79137 WP_000036371.1.79159 WP_000036371.1.79226 WP_000036371.1.79233 WP_000036371.1.79243 WP_000036371.1.79246 WP_000036371.1.79248 WP_000036371.1.79249 WP_000036371.1.79276 WP_000036371.1.79306 WP_000036371.1.79308 WP_000036371.1.79348 WP_000036371.1.79356 WP_000036371.1.79369 WP_000036371.1.79389 WP_000036371.1.79409 WP_000036371.1.79416 WP_000036371.1.79505 WP_000036371.1.7952 WP_000036371.1.79619 WP_000036371.1.79640 WP_000036371.1.7967 WP_000036371.1.79749 WP_000036371.1.79759 WP_000036371.1.79764 WP_000036371.1.79866 WP_000036371.1.79869 WP_000036371.1.7987 WP_000036371.1.79871 WP_000036371.1.79877 WP_000036371.1.7993 WP_000036371.1.79933 WP_000036371.1.79944 WP_000036371.1.79952 WP_000036371.1.79973 WP_000036371.1.80 WP_000036371.1.80011 WP_000036371.1.80026 WP_000036371.1.8004 WP_000036371.1.80050 WP_000036371.1.80063 WP_000036371.1.80096 WP_000036371.1.80106 WP_000036371.1.80168 WP_000036371.1.80179 WP_000036371.1.80183 WP_000036371.1.80192 WP_000036371.1.80388 WP_000036371.1.80392 WP_000036371.1.80402 WP_000036371.1.80456 WP_000036371.1.80519 WP_000036371.1.80545 WP_000036371.1.80594 WP_000036371.1.80612 WP_000036371.1.80660 WP_000036371.1.80666 WP_000036371.1.80676 WP_000036371.1.8068 WP_000036371.1.80718 WP_000036371.1.80731 WP_000036371.1.80736 WP_000036371.1.8074 WP_000036371.1.80756 WP_000036371.1.80768 WP_000036371.1.808 WP_000036371.1.80804 WP_000036371.1.80862 WP_000036371.1.80882 WP_000036371.1.8091 WP_000036371.1.80948 WP_000036371.1.80954 WP_000036371.1.81032 WP_000036371.1.81056 WP_000036371.1.81071 WP_000036371.1.81120 WP_000036371.1.81127 WP_000036371.1.81141 WP_000036371.1.81156 WP_000036371.1.8118 WP_000036371.1.81180 WP_000036371.1.8121 WP_000036371.1.81219 WP_000036371.1.81266 WP_000036371.1.81267 WP_000036371.1.81281 WP_000036371.1.8129 WP_000036371.1.81298 WP_000036371.1.81323 WP_000036371.1.814 WP_000036371.1.81484 WP_000036371.1.8156 WP_000036371.1.81576 WP_000036371.1.81577 WP_000036371.1.81588 WP_000036371.1.81602 WP_000036371.1.81688 WP_000036371.1.81692 WP_000036371.1.8172 WP_000036371.1.81761 WP_000036371.1.81806 WP_000036371.1.81819 WP_000036371.1.8183 WP_000036371.1.81881 WP_000036371.1.81888 WP_000036371.1.81935 WP_000036371.1.81952 WP_000036371.1.82032 WP_000036371.1.82061 WP_000036371.1.82074 WP_000036371.1.82095 WP_000036371.1.82104 WP_000036371.1.82106 WP_000036371.1.82116 WP_000036371.1.82123 WP_000036371.1.82221 WP_000036371.1.82280 WP_000036371.1.82320 WP_000036371.1.82330 WP_000036371.1.8235 WP_000036371.1.82438 WP_000036371.1.82514 WP_000036371.1.82536 WP_000036371.1.8255 WP_000036371.1.82614 WP_000036371.1.82661 WP_000036371.1.82691 WP_000036371.1.82698 WP_000036371.1.82700 WP_000036371.1.82705 WP_000036371.1.82711 WP_000036371.1.82718 WP_000036371.1.82747 WP_000036371.1.82780 WP_000036371.1.82784 WP_000036371.1.82808 WP_000036371.1.82816 WP_000036371.1.82833 WP_000036371.1.82901 WP_000036371.1.8295 WP_000036371.1.83033 WP_000036371.1.83051 WP_000036371.1.83059 WP_000036371.1.83097 WP_000036371.1.83118 WP_000036371.1.83140 WP_000036371.1.83144 WP_000036371.1.83160 WP_000036371.1.83177 WP_000036371.1.83214 WP_000036371.1.83238 WP_000036371.1.83253 WP_000036371.1.83256 WP_000036371.1.83330 WP_000036371.1.83415 WP_000036371.1.8345 WP_000036371.1.83466 WP_000036371.1.83644 WP_000036371.1.83660 WP_000036371.1.8368 WP_000036371.1.83781 WP_000036371.1.83820 WP_000036371.1.8384 WP_000036371.1.83879 WP_000036371.1.83911 WP_000036371.1.83941 WP_000036371.1.84004 WP_000036371.1.8405 WP_000036371.1.84059 WP_000036371.1.84074 WP_000036371.1.84185 WP_000036371.1.84210 WP_000036371.1.84215 WP_000036371.1.84221 WP_000036371.1.84298 WP_000036371.1.84319 WP_000036371.1.8444 WP_000036371.1.84462 WP_000036371.1.84464 WP_000036371.1.84467 WP_000036371.1.8447 WP_000036371.1.84476 WP_000036371.1.84486 WP_000036371.1.84518 WP_000036371.1.84531 WP_000036371.1.84639 WP_000036371.1.84675 WP_000036371.1.8470 WP_000036371.1.84731 WP_000036371.1.84738 WP_000036371.1.84768 WP_000036371.1.84797 WP_000036371.1.84878 WP_000036371.1.84894 WP_000036371.1.84916 WP_000036371.1.84929 WP_000036371.1.84972 WP_000036371.1.84977 WP_000036371.1.84989 WP_000036371.1.84994 WP_000036371.1.85025 WP_000036371.1.85048 WP_000036371.1.85077 WP_000036371.1.85090 WP_000036371.1.85106 WP_000036371.1.85125 WP_000036371.1.85138 WP_000036371.1.85141 WP_000036371.1.85156 WP_000036371.1.8517 WP_000036371.1.85241 WP_000036371.1.85252 WP_000036371.1.85305 WP_000036371.1.85310 WP_000036371.1.85315 WP_000036371.1.85323 WP_000036371.1.85329 WP_000036371.1.85336 WP_000036371.1.85361 WP_000036371.1.85369 WP_000036371.1.85385 WP_000036371.1.85546 WP_000036371.1.85554 WP_000036371.1.85563 WP_000036371.1.85578 WP_000036371.1.85593 WP_000036371.1.85601 WP_000036371.1.85623 WP_000036371.1.8564 WP_000036371.1.85685 WP_000036371.1.85767 WP_000036371.1.85773 WP_000036371.1.8579 WP_000036371.1.85793 WP_000036371.1.85800 WP_000036371.1.85806 WP_000036371.1.85895 WP_000036371.1.8592 WP_000036371.1.85948 WP_000036371.1.86 WP_000036371.1.86001 WP_000036371.1.86063 WP_000036371.1.86145 WP_000036371.1.86166 WP_000036371.1.86176 WP_000036371.1.8621 WP_000036371.1.86228 WP_000036371.1.86273 WP_000036371.1.86276 WP_000036371.1.86280 WP_000036371.1.86294 WP_000036371.1.8635 WP_000036371.1.86353 WP_000036371.1.86412 WP_000036371.1.86437 WP_000036371.1.86518 WP_000036371.1.8652 WP_000036371.1.8656 WP_000036371.1.86560 WP_000036371.1.86613 WP_000036371.1.86627 WP_000036371.1.86673 WP_000036371.1.86691 WP_000036371.1.86727 WP_000036371.1.86731 WP_000036371.1.86753 WP_000036371.1.86760 WP_000036371.1.86768 WP_000036371.1.86787 WP_000036371.1.86788 WP_000036371.1.8679 WP_000036371.1.86935 WP_000036371.1.86975 WP_000036371.1.87043 WP_000036371.1.87059 WP_000036371.1.87074 WP_000036371.1.87177 WP_000036371.1.87199 WP_000036371.1.87339 WP_000036371.1.87371 WP_000036371.1.87491 WP_000036371.1.87574 WP_000036371.1.87608 WP_000036371.1.87635 WP_000036371.1.87655 WP_000036371.1.8771 WP_000036371.1.87726 WP_000036371.1.87766 WP_000036371.1.8778 WP_000036371.1.87786 WP_000036371.1.87834 WP_000036371.1.87857 WP_000036371.1.87914 WP_000036371.1.87984 WP_000036371.1.87990 WP_000036371.1.880 WP_000036371.1.88066 WP_000036371.1.88082 WP_000036371.1.88119 WP_000036371.1.88147 WP_000036371.1.88189 WP_000036371.1.8822 WP_000036371.1.88336 WP_000036371.1.88352 WP_000036371.1.88438 WP_000036371.1.88467 WP_000036371.1.88499 WP_000036371.1.88505 WP_000036371.1.8854 WP_000036371.1.8855 WP_000036371.1.88577 WP_000036371.1.88603 WP_000036371.1.88646 WP_000036371.1.88678 WP_000036371.1.88685 WP_000036371.1.88710 WP_000036371.1.88711 WP_000036371.1.88720 WP_000036371.1.88729 WP_000036371.1.8873 WP_000036371.1.88752 WP_000036371.1.88767 WP_000036371.1.88826 WP_000036371.1.88864 WP_000036371.1.88950 WP_000036371.1.88953 WP_000036371.1.88961 WP_000036371.1.89018 WP_000036371.1.89043 WP_000036371.1.89069 WP_000036371.1.89097 WP_000036371.1.89111 WP_000036371.1.89163 WP_000036371.1.89165 WP_000036371.1.89197 WP_000036371.1.89203 WP_000036371.1.89255 WP_000036371.1.89285 WP_000036371.1.89305 WP_000036371.1.89335 WP_000036371.1.89396 WP_000036371.1.894 WP_000036371.1.89400 WP_000036371.1.89403 WP_000036371.1.89416 WP_000036371.1.89466 WP_000036371.1.89468 WP_000036371.1.89469 WP_000036371.1.89492 WP_000036371.1.89510 WP_000036371.1.89551 WP_000036371.1.89583 WP_000036371.1.89605 WP_000036371.1.89656 WP_000036371.1.89700 WP_000036371.1.89710 WP_000036371.1.89788 WP_000036371.1.89841 WP_000036371.1.89879 WP_000036371.1.89899 WP_000036371.1.89917 WP_000036371.1.89923 WP_000036371.1.89925 WP_000036371.1.89927 WP_000036371.1.89977 WP_000036371.1.90050 WP_000036371.1.90115 WP_000036371.1.90128 WP_000036371.1.90182 WP_000036371.1.902 WP_000036371.1.90205 WP_000036371.1.90249 WP_000036371.1.90346 WP_000036371.1.90357 WP_000036371.1.90358 WP_000036371.1.90389 WP_000036371.1.90511 WP_000036371.1.90520 WP_000036371.1.90690 WP_000036371.1.90703 WP_000036371.1.90758 WP_000036371.1.90775 WP_000036371.1.90799 WP_000036371.1.90839 WP_000036371.1.9084 WP_000036371.1.90865 WP_000036371.1.909 WP_000036371.1.90905 WP_000036371.1.90924 WP_000036371.1.90996 WP_000036371.1.91007 WP_000036371.1.91010 WP_000036371.1.91117 WP_000036371.1.91138 WP_000036371.1.91143 WP_000036371.1.9118 WP_000036371.1.91182 WP_000036371.1.91213 WP_000036371.1.91354 WP_000036371.1.91361 WP_000036371.1.91397 WP_000036371.1.91425 WP_000036371.1.91445 WP_000036371.1.91526 WP_000036371.1.91543 WP_000036371.1.91549 WP_000036371.1.91566 WP_000036371.1.91594 WP_000036371.1.91626 WP_000036371.1.91630 WP_000036371.1.91640 WP_000036371.1.91643 WP_000036371.1.9169 WP_000036371.1.91701 WP_000036371.1.91756 WP_000036371.1.91777 WP_000036371.1.91779 WP_000036371.1.91793 WP_000036371.1.91965 WP_000036371.1.92005 WP_000036371.1.92019 WP_000036371.1.92029 WP_000036371.1.9209 WP_000036371.1.92114 WP_000036371.1.92161 WP_000036371.1.92180 WP_000036371.1.92195 WP_000036371.1.92224 WP_000036371.1.92304 WP_000036371.1.92323 WP_000036371.1.92384 WP_000036371.1.924 WP_000036371.1.92462 WP_000036371.1.92473 WP_000036371.1.92495 WP_000036371.1.92496 WP_000036371.1.92506 WP_000036371.1.92535 WP_000036371.1.92571 WP_000036371.1.92634 WP_000036371.1.92638 WP_000036371.1.92767 WP_000036371.1.92781 WP_000036371.1.92793 WP_000036371.1.92796 WP_000036371.1.92845 WP_000036371.1.92882 WP_000036371.1.92886 WP_000036371.1.92991 WP_000036371.1.93017 WP_000036371.1.93052 WP_000036371.1.93085 WP_000036371.1.93112 WP_000036371.1.93138 WP_000036371.1.93139 WP_000036371.1.93167 WP_000036371.1.93185 WP_000036371.1.93267 WP_000036371.1.9327 WP_000036371.1.93309 WP_000036371.1.9331 WP_000036371.1.93461 WP_000036371.1.93464 WP_000036371.1.93468 WP_000036371.1.9356 WP_000036371.1.93621 WP_000036371.1.93634 WP_000036371.1.93637 WP_000036371.1.93716 WP_000036371.1.93737 WP_000036371.1.93742 WP_000036371.1.93765 WP_000036371.1.93768 WP_000036371.1.938 WP_000036371.1.93800 WP_000036371.1.93870 WP_000036371.1.939 WP_000036371.1.93900 WP_000036371.1.93921 WP_000036371.1.93939 WP_000036371.1.93971 WP_000036371.1.94011 WP_000036371.1.94025 WP_000036371.1.94028 WP_000036371.1.94040 WP_000036371.1.94176 WP_000036371.1.94187 WP_000036371.1.94367 WP_000036371.1.94417 WP_000036371.1.94429 WP_000036371.1.94430 WP_000036371.1.94436 WP_000036371.1.94445 WP_000036371.1.94497 WP_000036371.1.94516 WP_000036371.1.94523 WP_000036371.1.94548 WP_000036371.1.94578 WP_000036371.1.94626 WP_000036371.1.94646 WP_000036371.1.94653 WP_000036371.1.94686 WP_000036371.1.94690 WP_000036371.1.94692 WP_000036371.1.94695 WP_000036371.1.94739 WP_000036371.1.94753 WP_000036371.1.94801 WP_000036371.1.94806 WP_000036371.1.94823 WP_000036371.1.94836 WP_000036371.1.94841 WP_000036371.1.94847 WP_000036371.1.94869 WP_000036371.1.94892 WP_000036371.1.94898 WP_000036371.1.949 WP_000036371.1.94934 WP_000036371.1.94935 WP_000036371.1.94955 WP_000036371.1.94963 WP_000036371.1.94997 WP_000036371.1.95036 WP_000036371.1.95080 WP_000036371.1.95084 WP_000036371.1.95105 WP_000036371.1.95233 WP_000036371.1.95275 WP_000036371.1.95329 WP_000036371.1.95366 WP_000036371.1.95378 WP_000036371.1.95395 WP_000036371.1.95398 WP_000036371.1.95403 WP_000036371.1.95428 WP_000036371.1.95431 WP_000036371.1.95518 WP_000036371.1.95611 WP_000036371.1.95628 WP_000036371.1.9566 WP_000036371.1.95666 WP_000036371.1.95680 WP_000036371.1.95756 WP_000036371.1.95759 WP_000036371.1.95783 WP_000036371.1.95821 WP_000036371.1.95835 WP_000036371.1.95846 WP_000036371.1.95861 WP_000036371.1.95919 WP_000036371.1.95929 WP_000036371.1.95951 WP_000036371.1.960 WP_000036371.1.96015 WP_000036371.1.96032 WP_000036371.1.96086 WP_000036371.1.96110 WP_000036371.1.96145 WP_000036371.1.96223 WP_000036371.1.96278 WP_000036371.1.96279 WP_000036371.1.96281 WP_000036371.1.96293 WP_000036371.1.9631 WP_000036371.1.96339 WP_000036371.1.96378 WP_000036371.1.96394 WP_000036371.1.96417 WP_000036371.1.96420 WP_000036371.1.96479 WP_000036371.1.96484 WP_000036371.1.96558 WP_000036371.1.96609 WP_000036371.1.96683 WP_000036371.1.96701 WP_000036371.1.9671 WP_000036371.1.96753 WP_000036371.1.96762 WP_000036371.1.96779 WP_000036371.1.9682 WP_000036371.1.96820 WP_000036371.1.96894 WP_000036371.1.9690 WP_000036371.1.96984 WP_000036371.1.96989 WP_000036371.1.97011 WP_000036371.1.97027 WP_000036371.1.9708 WP_000036371.1.97119 WP_000036371.1.97147 WP_000036371.1.97195 WP_000036371.1.97226 WP_000036371.1.9723 WP_000036371.1.97238 WP_000036371.1.97247 WP_000036371.1.97269 WP_000036371.1.97292 WP_000036371.1.97351 WP_000036371.1.97360 WP_000036371.1.97379 WP_000036371.1.97437 WP_000036371.1.97459 WP_000036371.1.97464 WP_000036371.1.9747 WP_000036371.1.97527 WP_000036371.1.97538 WP_000036371.1.97549 WP_000036371.1.97571 WP_000036371.1.97619 WP_000036371.1.97675 WP_000036371.1.97677 WP_000036371.1.97711 WP_000036371.1.97775 WP_000036371.1.978 WP_000036371.1.97802 WP_000036371.1.97825 WP_000036371.1.97890 WP_000036371.1.97895 WP_000036371.1.97919 WP_000036371.1.98000 WP_000036371.1.98012 WP_000036371.1.98167 WP_000036371.1.98202 WP_000036371.1.98208 WP_000036371.1.98241 WP_000036371.1.98244 WP_000036371.1.98284 WP_000036371.1.98404 WP_000036371.1.98429 WP_000036371.1.9844 WP_000036371.1.98442 WP_000036371.1.98466 WP_000036371.1.98498 WP_000036371.1.98603 WP_000036371.1.98626 WP_000036371.1.98633 WP_000036371.1.98641 WP_000036371.1.98668 WP_000036371.1.98784 WP_000036371.1.98886 WP_000036371.1.98908 WP_000036371.1.98976 WP_000036371.1.99006 WP_000036371.1.99053 WP_000036371.1.99060 WP_000036371.1.9907 WP_000036371.1.99110 WP_000036371.1.99209 WP_000036371.1.99292 WP_000036371.1.99307 WP_000036371.1.99310 WP_000036371.1.99319 WP_000036371.1.99349 WP_000036371.1.99400 WP_000036371.1.99427 WP_000036371.1.99446 WP_000036371.1.99472 WP_000036371.1.99498 WP_000036371.1.99571 WP_000036371.1.99641 WP_000036371.1.99694 WP_000036371.1.99698 WP_000036371.1.99734 WP_000036371.1.99771 WP_000036371.1.99774 WP_000036371.1.99791 WP_000036371.1.99892 WP_000036371.1.99912 WP_000036371.1.99929 YP_002407175.1.10275 YP_002412902.1.14968 YP_006120243.1.29421 gi|251785331|ref|YP_002999635.1| gi|254161943|ref|YP_003045051.1| gi|387617221|ref|YP_006120243.1| gi|386639409|ref|YP_006106207.1| gi|215487095|ref|YP_002329526.1| gi|386629586|ref|YP_006149306.1| gi|443617963|ref|YP_007381819.1| gi|26248150|ref|NP_754190.1| gi|386624512|ref|YP_006144240.1| gi|387612370|ref|YP_006115486.1| 199310.c2298 300269.SSON_1234 331112.EcHS_A1979 413997.ECB_01854 469008.ECBD_1755 481805.EcolC_1749 574521.E2348C_2007 585056.ECUMN_2180 585057.ECIAI39_1167 gi|251785331|ref|YP_002999635.1| gi|386619468|ref|YP_006139048.1| gi|386634506|ref|YP_006154225.1| gi|157161355|ref|YP_001458673.1| gi|222156626|ref|YP_002556765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]