SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063KS30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063KS30
Domain Number 1 Region: 26-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000106
Family Family 1 bi-partite nucleotidyltransferase subunit 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A063KS30
Sequence length 141
Comment (tr|A0A063KS30|A0A063KS30_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KDC50702.1} KW=Complete proteome; Reference proteome OX=1872678 OS=Pseudoalteromonas fuliginea. GN=DC53_11545 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MTDTGITLYLSEVTRHIDEYMQELDELSQIDSLNSRDYRAAERLLQLMTEVCIGLSKHWL
KQHKSSTSSNAYQTFSELTNLGFLSEVELLSWRKIIGLRNALVHDYLNIDQSIVKTIIKK
QHYITMHAFSIKAITELNKDS
Download sequence
Identical sequences A0A063KS30 G7G7Z6
WP_007379065.1.41168 WP_007379065.1.65950 WP_007379065.1.69430 WP_007379065.1.71801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]