SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063KSX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063KSX3
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.71e-37
Family Sfri0576-like 0.00000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A063KSX3
Sequence length 126
Comment (tr|A0A063KSX3|A0A063KSX3_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KDC53168.1} KW=Complete proteome; Reference proteome OX=1872678 OS=Pseudoalteromonas fuliginea. GN=DC53_02450 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MVHTTHGLSIGLKRAGREFFLKLKAVGTLTHDDYKIITPMINSALGEVKHPVVNALIDGS
ELEGWELRAAWDDLKLGVKHSKEFKKVAIYGNKEWQARMAKIGNWFISGEVQYFENATAA
IDWLDE
Download sequence
Identical sequences A0A063KSX3
WP_033028502.1.41168 WP_033028502.1.69430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]