SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A063X4Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063X4Q7
Domain Number 1 Region: 444-554
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000053
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A063X4Q7
Sequence length 563
Comment (tr|A0A063X4Q7|A0A063X4Q7_ACEAC) Transporter {ECO:0000313|EMBL:KDE19632.1} KW=Complete proteome OX=1457393 OS=Acetobacter aceti 1023. GN=AZ09_11700 OC=Acetobacteraceae; Acetobacter; Acetobacter subgen. Acetobacter.
Sequence
MAPLSGIKKWFGQRITKKSGSWSDMLAGLSLASMNIPQVLGYARIAEMPAVCGLYTVLFP
LVAFALFGSSRHLVVAADSATAAIFSSGLSEIVSPGSARYMELVSTVALLNAGFLLVARL
CRLGFLADFLSRTVLVGFLAGVGVQVGLSMLYDMTGLVSNSHNTLVQAVGLFQGFGQMQG
LSIAIASLSCVVLLAGTRQKPHWPIGLCVVLVSIFCSWGLNLQHYDVAILGSIRGGLPAF
SVPVPGWHDVLALLPISASCVFVIIAQSAATSRAFANMFHEHVDENADIVGLCAANAAAA
LTGTFTVNGSPTQTAMAVQAGARSQKAQLVFAAVTACVLLFFPAPLQYLPRCVLGAIVFC
VAIRMIDIQALVHIRDESPGEFRLALVTAATVVSVGVEQGIFIAIALSLFRHVRHSYMPH
TLVMAPEPTTGILEAQAVAPGEQSMPGIIIYRFCADLFYANCNLFTDDIMELVSSAPNPV
KCIVVDCSAITDIDYSAAQVVRDVLQQLHARGITVLFGRVAPFFLKDMDRHHITPVLGKE
NIYMQLHTALASARKLCGDAKAL
Download sequence
Identical sequences A0A063X4Q7
WP_042788414.1.24427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]