SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063YEZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063YEZ9
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily S13-like H2TH domain 5.36e-44
Family Ribosomal protein S13 0.000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A063YEZ9
Sequence length 124
Comment (tr|A0A063YEZ9|A0A063YEZ9_9MOLU) 30S ribosomal protein S13 {ECO:0000256|HAMAP-Rule:MF_01315} KW=Complete proteome; Reference proteome OX=29559 OS=Mycoplasma hyosynoviae. GN=NPL3_02770 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MARVLNIEIPNNKRVVISLTYIYGIGRTLASKICLAAKVDESKRVKDLTEDELTRIRDEA
KKYTTEGDLRREVNLNIKRLMEIKSYRGMRHRKGLPVRGQCTQKNARTRKGPRKTIAGKK
GNTK
Download sequence
Identical sequences A0A063YEZ9
WP_036445197.1.25000 WP_036445197.1.34938 WP_036445197.1.66124 WP_036445197.1.71550 WP_036445197.1.78277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]