SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063Z9J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063Z9J4
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily AF1782-like 7.32e-18
Family AF1782-like 0.0043
Further Details:      
 
Domain Number 2 Region: 100-178
Classification Level Classification E-value
Superfamily AF1782-like 6.28e-17
Family AF1782-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A063Z9J4
Sequence length 189
Comment (tr|A0A063Z9J4|A0A063Z9J4_9EURY) Uncharacterized protein {ECO:0000313|EMBL:KDE55408.1} KW=Complete proteome OX=1495314 OS=Methanoculleus sp. MH98A. GN=EI28_07095 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MNLDDYAALYGEALSPVRTAVPEGTLLCRAAGEVLEMAIAYHSDGLAFLRGGDRVNALAA
FAYGFGWLDAGSRLGLLAPSSAHPPDTVAACIPESQAARLEEKTHRYRRMLDAALGAVEA
AADEASPLHAGAGEFYSTARTRYAEGVEYLDAGDLAAALARFSYGYAWLDAGIRAGLFRI
TGERGLFTV
Download sequence
Identical sequences A0A063Z9J4
WP_052379688.1.69318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]