SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A063ZJQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063ZJQ3
Domain Number 1 Region: 195-462
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.66e-66
Family PFOR Pyr module 0.071
Further Details:      
 
Domain Number 2 Region: 6-220
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0044
Further Details:      
 
Domain Number 3 Region: 471-576
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000484
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A063ZJQ3
Sequence length 585
Comment (tr|A0A063ZJQ3|A0A063ZJQ3_9EURY) Oxoglutarate--ferredoxin oxidoreductase {ECO:0000313|EMBL:KDE58289.1} KW=Complete proteome; Reference proteome OX=1495067 OS=Halostagnicola sp. A56. GN=EL22_05895 OC=Halostagnicola.
Sequence
MAADLNWAIGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKIRTSVDQ
VQSVVDRLDILVALTQRTIDENLDELHDGSAVIYDGERSWEAEIPDEITAVDVPLKSLAE
DAGGAIMRNIVALGAACEITNFDVEYLDESLEKRFGGKGSKIVENNKEAARLGQEYVREN
YDFEELGYDLETTDNDYVLLNGNEAIGMGAIAAGCRFYAGYPITPATSIMEYLTGRIEDY
GGHVVQAEDELSAINMALGGARAGARAMTATSGAGIDLMTETFGLVATSETPLVICDVQR
SGPSTGMPTKQEQGDLNMALYAGHGEVPRFVVTPTTITECFWKTVEAFNLAEKYQTPVFL
VSDLAMSVTEQTFPPEAFDMDAVEIDRGKLVEQDEVDEWLDDEGRFRAHAVTDDGVSPRA
KPGTIDGAHMSTGLEHDELGRRTEEEDERVQQVDKRNRKVETAKEREEWDYREFGDADSE
NLIISWGSNEGALVEALEYLEDDGISVRVISVPYIFPRPDLTEEIEAAEEAIVVECNATG
QFADLLEHDALTRLKRINKYTGVRFKADELATEITDKLAEEVPAQ
Download sequence
Identical sequences A0A063ZJQ3
WP_050051482.1.22741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]