SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A064E4R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A064E4R7
Domain Number 1 Region: 442-548
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A064E4R7
Sequence length 551
Comment (tr|A0A064E4R7|A0A064E4R7_CITFR) Uncharacterized protein {ECO:0000313|EMBL:KDF17874.1} KW=Complete proteome OX=1439318 OS=Citrobacter freundii MGH 56. GN=AF42_01199 OC=Enterobacteriaceae; Citrobacter; Citrobacter freundii complex.
Sequence
MPFRALIDACWKEKYTASRFTRDLIAGITVGIIAIPLAMALAIGSGVAPQYGLYTSAVAG
IVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLMSGIFLILFGLARFGRLIE
YIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPTINVGDAAIG
VVTLGILIFWPRLGIRLPGHLPALLAGCAVMGIVNLTGGHVATIGSQFHYILADGSQGNG
IPQLLPQLVLPWNMPESNFTLSWSSLQALLPAAFSMAMLGAIESLLCAVVLDGMTGTKHK
ANSELIGQGLGNIVAPFFGGITATAAIARSAANVRAGATSPISAVIHAILVILALLVLAP
LLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLMCMSLTVLFDMVIAISV
GIVLASLLFMRRIARMTRLAPVNIDVPEDVLVLRVIGPLFFAAAEGLFTDLESRIEGKRI
VVLKWDAVPVLDAGGLDAFQRFVKRLPEGCELRISNLEFQPLRTMARAGIQPIAGRLTFF
PNKDAALADII
Download sequence
Identical sequences A0A064E4R7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]