SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A066NNC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066NNC2
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.27e-75
Family Methylesterase CheB, C-terminal domain 0.00000000787
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 5.55e-28
Family CheY-related 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066NNC2
Sequence length 349
Comment (tr|A0A066NNC2|A0A066NNC2_LELAM) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1439331 OS=Lelliottia amnigena CHS 78. GN=AF34_03912 OC=Enterobacteriaceae; Lelliottia.
Sequence
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKYNPDVLTLDVEMP
RMDGIDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAVDFVTKPQLGIREGMLAYS
EMIAEKIRTASRAKLAAHKPMAAPATLKAGPLLSSEKLLVIGASTGGTEAIRHVLQPLPL
SSPGILITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMHQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
Download sequence
Identical sequences A0A066NNC2 A0A0D9HAN2 A0A0E1JAH7 A0A0F1AX80 A0A0J1VZJ6 A0A0M2BZ91 A0A0V9EDJ4 A0A145MTZ0 A0A167IHX6 A0A169L7Q5 A0A1V3X7U6 A0A1V6M8E1 A0A2I1ZTG5 A0A2I2BJ53 A0A2J5VKH9 A0A2J7T9I9
WP_014884341.1.100009 WP_014884341.1.100262 WP_014884341.1.100515 WP_014884341.1.100591 WP_014884341.1.100926 WP_014884341.1.101049 WP_014884341.1.101104 WP_014884341.1.10113 WP_014884341.1.101675 WP_014884341.1.101715 WP_014884341.1.101854 WP_014884341.1.10334 WP_014884341.1.10438 WP_014884341.1.10710 WP_014884341.1.10864 WP_014884341.1.10865 WP_014884341.1.10971 WP_014884341.1.11187 WP_014884341.1.11400 WP_014884341.1.12196 WP_014884341.1.12425 WP_014884341.1.12513 WP_014884341.1.12842 WP_014884341.1.13066 WP_014884341.1.1310 WP_014884341.1.13231 WP_014884341.1.13462 WP_014884341.1.1349 WP_014884341.1.13895 WP_014884341.1.13935 WP_014884341.1.14059 WP_014884341.1.14321 WP_014884341.1.14427 WP_014884341.1.14449 WP_014884341.1.14692 WP_014884341.1.15044 WP_014884341.1.15133 WP_014884341.1.1531 WP_014884341.1.15357 WP_014884341.1.15580 WP_014884341.1.15748 WP_014884341.1.16030 WP_014884341.1.16085 WP_014884341.1.16122 WP_014884341.1.16149 WP_014884341.1.16350 WP_014884341.1.16810 WP_014884341.1.16848 WP_014884341.1.16863 WP_014884341.1.16943 WP_014884341.1.17275 WP_014884341.1.17437 WP_014884341.1.17507 WP_014884341.1.17510 WP_014884341.1.17862 WP_014884341.1.18075 WP_014884341.1.18332 WP_014884341.1.18491 WP_014884341.1.18518 WP_014884341.1.18544 WP_014884341.1.19220 WP_014884341.1.19570 WP_014884341.1.19610 WP_014884341.1.19825 WP_014884341.1.19849 WP_014884341.1.19966 WP_014884341.1.20040 WP_014884341.1.20061 WP_014884341.1.2018 WP_014884341.1.20193 WP_014884341.1.20555 WP_014884341.1.20556 WP_014884341.1.20871 WP_014884341.1.20995 WP_014884341.1.21439 WP_014884341.1.21483 WP_014884341.1.21541 WP_014884341.1.21649 WP_014884341.1.21870 WP_014884341.1.22212 WP_014884341.1.22223 WP_014884341.1.22430 WP_014884341.1.2264 WP_014884341.1.22646 WP_014884341.1.23892 WP_014884341.1.25550 WP_014884341.1.256 WP_014884341.1.25876 WP_014884341.1.2639 WP_014884341.1.26530 WP_014884341.1.26954 WP_014884341.1.27212 WP_014884341.1.27591 WP_014884341.1.28324 WP_014884341.1.29212 WP_014884341.1.29273 WP_014884341.1.29409 WP_014884341.1.29612 WP_014884341.1.29739 WP_014884341.1.30345 WP_014884341.1.30412 WP_014884341.1.30594 WP_014884341.1.30604 WP_014884341.1.30839 WP_014884341.1.30852 WP_014884341.1.31249 WP_014884341.1.31255 WP_014884341.1.31268 WP_014884341.1.31470 WP_014884341.1.31593 WP_014884341.1.31942 WP_014884341.1.3210 WP_014884341.1.3218 WP_014884341.1.32220 WP_014884341.1.32238 WP_014884341.1.32901 WP_014884341.1.3292 WP_014884341.1.32958 WP_014884341.1.33497 WP_014884341.1.33500 WP_014884341.1.33608 WP_014884341.1.34582 WP_014884341.1.34658 WP_014884341.1.35259 WP_014884341.1.35292 WP_014884341.1.35511 WP_014884341.1.35667 WP_014884341.1.36012 WP_014884341.1.36120 WP_014884341.1.36466 WP_014884341.1.37211 WP_014884341.1.37315 WP_014884341.1.37401 WP_014884341.1.37462 WP_014884341.1.37908 WP_014884341.1.38189 WP_014884341.1.38221 WP_014884341.1.38255 WP_014884341.1.38902 WP_014884341.1.39380 WP_014884341.1.39720 WP_014884341.1.39969 WP_014884341.1.4013 WP_014884341.1.40460 WP_014884341.1.41385 WP_014884341.1.41590 WP_014884341.1.41670 WP_014884341.1.41767 WP_014884341.1.41788 WP_014884341.1.41953 WP_014884341.1.41967 WP_014884341.1.42124 WP_014884341.1.42527 WP_014884341.1.42589 WP_014884341.1.42877 WP_014884341.1.42968 WP_014884341.1.43048 WP_014884341.1.43620 WP_014884341.1.43860 WP_014884341.1.44459 WP_014884341.1.44669 WP_014884341.1.44670 WP_014884341.1.4477 WP_014884341.1.45046 WP_014884341.1.4551 WP_014884341.1.45786 WP_014884341.1.45800 WP_014884341.1.4608 WP_014884341.1.4609 WP_014884341.1.46165 WP_014884341.1.46415 WP_014884341.1.47333 WP_014884341.1.47788 WP_014884341.1.47916 WP_014884341.1.48221 WP_014884341.1.48574 WP_014884341.1.48760 WP_014884341.1.49618 WP_014884341.1.49652 WP_014884341.1.49797 WP_014884341.1.49826 WP_014884341.1.49836 WP_014884341.1.50494 WP_014884341.1.50523 WP_014884341.1.50858 WP_014884341.1.51121 WP_014884341.1.51196 WP_014884341.1.51695 WP_014884341.1.51737 WP_014884341.1.51984 WP_014884341.1.52483 WP_014884341.1.52580 WP_014884341.1.5270 WP_014884341.1.53160 WP_014884341.1.53164 WP_014884341.1.54195 WP_014884341.1.54756 WP_014884341.1.54933 WP_014884341.1.55681 WP_014884341.1.5638 WP_014884341.1.56578 WP_014884341.1.56618 WP_014884341.1.56693 WP_014884341.1.56802 WP_014884341.1.5717 WP_014884341.1.57454 WP_014884341.1.57605 WP_014884341.1.57748 WP_014884341.1.57759 WP_014884341.1.58732 WP_014884341.1.58757 WP_014884341.1.5900 WP_014884341.1.59053 WP_014884341.1.59408 WP_014884341.1.59448 WP_014884341.1.59623 WP_014884341.1.59653 WP_014884341.1.59923 WP_014884341.1.60348 WP_014884341.1.60892 WP_014884341.1.60951 WP_014884341.1.61332 WP_014884341.1.61367 WP_014884341.1.61545 WP_014884341.1.61725 WP_014884341.1.61855 WP_014884341.1.61909 WP_014884341.1.62117 WP_014884341.1.62125 WP_014884341.1.62469 WP_014884341.1.62517 WP_014884341.1.62542 WP_014884341.1.62870 WP_014884341.1.63 WP_014884341.1.63178 WP_014884341.1.63223 WP_014884341.1.63389 WP_014884341.1.63396 WP_014884341.1.63447 WP_014884341.1.63547 WP_014884341.1.637 WP_014884341.1.63889 WP_014884341.1.64183 WP_014884341.1.6435 WP_014884341.1.64354 WP_014884341.1.64612 WP_014884341.1.64623 WP_014884341.1.64642 WP_014884341.1.65594 WP_014884341.1.65618 WP_014884341.1.65640 WP_014884341.1.6631 WP_014884341.1.6651 WP_014884341.1.66660 WP_014884341.1.66944 WP_014884341.1.67439 WP_014884341.1.67474 WP_014884341.1.67919 WP_014884341.1.680 WP_014884341.1.68006 WP_014884341.1.68316 WP_014884341.1.68400 WP_014884341.1.68694 WP_014884341.1.68950 WP_014884341.1.69141 WP_014884341.1.69289 WP_014884341.1.69423 WP_014884341.1.69713 WP_014884341.1.69833 WP_014884341.1.69874 WP_014884341.1.69892 WP_014884341.1.70099 WP_014884341.1.70186 WP_014884341.1.70419 WP_014884341.1.70483 WP_014884341.1.70812 WP_014884341.1.70819 WP_014884341.1.70825 WP_014884341.1.71018 WP_014884341.1.71112 WP_014884341.1.71169 WP_014884341.1.71173 WP_014884341.1.71318 WP_014884341.1.71342 WP_014884341.1.71422 WP_014884341.1.71445 WP_014884341.1.72020 WP_014884341.1.72395 WP_014884341.1.72955 WP_014884341.1.74021 WP_014884341.1.74068 WP_014884341.1.74146 WP_014884341.1.74170 WP_014884341.1.74669 WP_014884341.1.74744 WP_014884341.1.74910 WP_014884341.1.75172 WP_014884341.1.75512 WP_014884341.1.75531 WP_014884341.1.75924 WP_014884341.1.76349 WP_014884341.1.76665 WP_014884341.1.76688 WP_014884341.1.77076 WP_014884341.1.77817 WP_014884341.1.77910 WP_014884341.1.78743 WP_014884341.1.78829 WP_014884341.1.80075 WP_014884341.1.80172 WP_014884341.1.80541 WP_014884341.1.80834 WP_014884341.1.80933 WP_014884341.1.8094 WP_014884341.1.81239 WP_014884341.1.81363 WP_014884341.1.82926 WP_014884341.1.83075 WP_014884341.1.83095 WP_014884341.1.83133 WP_014884341.1.83194 WP_014884341.1.8337 WP_014884341.1.83391 WP_014884341.1.83453 WP_014884341.1.83629 WP_014884341.1.83903 WP_014884341.1.84101 WP_014884341.1.84425 WP_014884341.1.84479 WP_014884341.1.84709 WP_014884341.1.85058 WP_014884341.1.85159 WP_014884341.1.85482 WP_014884341.1.85794 WP_014884341.1.85871 WP_014884341.1.86111 WP_014884341.1.86251 WP_014884341.1.86396 WP_014884341.1.864 WP_014884341.1.86421 WP_014884341.1.86567 WP_014884341.1.87337 WP_014884341.1.87781 WP_014884341.1.87950 WP_014884341.1.88018 WP_014884341.1.8833 WP_014884341.1.88665 WP_014884341.1.88822 WP_014884341.1.88919 WP_014884341.1.89490 WP_014884341.1.89743 WP_014884341.1.90685 WP_014884341.1.91055 WP_014884341.1.91323 WP_014884341.1.91575 WP_014884341.1.92050 WP_014884341.1.92214 WP_014884341.1.92287 WP_014884341.1.92418 WP_014884341.1.92542 WP_014884341.1.93751 WP_014884341.1.94120 WP_014884341.1.94664 WP_014884341.1.94939 WP_014884341.1.95252 WP_014884341.1.95480 WP_014884341.1.95582 WP_014884341.1.96009 WP_014884341.1.96082 WP_014884341.1.96121 WP_014884341.1.96511 WP_014884341.1.96952 WP_014884341.1.9702 WP_014884341.1.97115 WP_014884341.1.97258 WP_014884341.1.97431 WP_014884341.1.97564 WP_014884341.1.97718 WP_014884341.1.9777 WP_014884341.1.97924 WP_014884341.1.98287 WP_014884341.1.9846 WP_014884341.1.98592 WP_014884341.1.98930 WP_014884341.1.98962 WP_014884341.1.99807 WP_014884341.1.9982 WP_014884341.1.99947 WP_014884341.1.99951 gi|401764227|ref|YP_006579234.1| 2030317135 2031828444 2030420926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]