SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A066RQV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066RQV2
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-41
Family Sfri0576-like 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066RQV2
Sequence length 126
Comment (tr|A0A066RQV2|A0A066RQV2_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KDM89758.1} KW=Complete proteome; Reference proteome OX=1654360 OS=Photobacterium galatheae. GN=EA58_20085 OC=Vibrionaceae; Photobacterium.
Sequence
MQTTHGLFFEVDRDGDHFFMELKAVGKLTHEDYEQITPLIDEALAGIEHPKVNVYFDGSD
FEGWELKAAWDDLKLGLKHGKKFNRIAIYSDKKWMDVMAKVGNWFISGEVKCFDTPVDAL
AWLREE
Download sequence
Identical sequences A0A066RQV2
WP_036756710.1.33314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]