SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066T6V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066T6V0
Domain Number 1 Region: 92-163
Classification Level Classification E-value
Superfamily YajQ-like 4.18e-30
Family YajQ-like 0.0000498
Further Details:      
 
Domain Number 2 Region: 2-89
Classification Level Classification E-value
Superfamily YajQ-like 5.75e-30
Family YajQ-like 0.0000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A066T6V0
Sequence length 163
Comment (tr|A0A066T6V0|A0A066T6V0_9GAMM) UPF0234 protein A9G37_10895 {ECO:0000256|HAMAP-Rule:MF_00632} KW=Complete proteome OX=1196095 OS=Gilliamella apicola. GN=A9G37_10895 OC=Gilliamella.
Sequence
MPSFDIVSEIQMPEVKNGVENATRELATRWDFKNVEASFELNEKNETIKVTSQSDFQVQQ
LLDILRDKLAKRGIDGGALEIPEEMEHSGKLYSITVKLKQGIDKELAKKIVKAIKDSKIK
VQAQVQGEQVRVTGKSRDDLQTTMALVKNSEFGQPFQFTNFRD
Download sequence
Identical sequences A0A066T6V0
WP_034910675.1.100467 WP_034910675.1.19953 WP_034910675.1.35759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]