SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A066UJ31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066UJ31
Domain Number 1 Region: 6-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000161
Family Anti-sigma factor antagonist SpoIIaa 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066UJ31
Sequence length 126
Comment (tr|A0A066UJ31|A0A066UJ31_9PSEU) Uncharacterized protein {ECO:0000313|EMBL:KDN24208.1} KW=Complete proteome OX=287986 OS=Amycolatopsis rifamycinica. GN=DV20_00515 OC=Amycolatopsis.
Sequence
MREDDIATEHSGGVLVVEMRGEPDIDAVRQRTGALEAAVCELPGPPLLVLDLGKLEFLSV
RGVRGLQDVIERCRTRRIAGCLIVPPGSEVERVVRLTGLAGRVPVFPHRLLAIARYQPVE
MRWLPR
Download sequence
Identical sequences A0A066UJ31
WP_043775137.1.55407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]