SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066UZG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066UZG1
Domain Number 1 Region: 7-132
Classification Level Classification E-value
Superfamily DsrEFH-like 8.24e-38
Family DsrEF-like 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A066UZG1
Sequence length 132
Comment (tr|A0A066UZG1|A0A066UZG1_9VIBR) Sulfur transfer complex subunit TusD {ECO:0000313|EMBL:KDN29624.1} KW=Complete proteome OX=212667 OS=Vibrio fortis. GN=VFDL14_12305 OC=Vibrionaceae; Vibrio.
Sequence
MSSNLTYTLLVNGPIYGSQSAKNAYQFALALIERGHQLKSVFFYQDGVSNGSALTVPAND
EFDLAGAWQKLASQHEVRLETCVAAALRRGVVSEDEANQHQLENHNLADGFEQAGLGSLA
EAMLTQDRVVQF
Download sequence
Identical sequences A0A066UZG1
WP_032550044.1.51568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]