SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066W7K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066W7K1
Domain Number 1 Region: 7-70
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.38e-18
Family PHD domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066W7K1
Sequence length 93
Comment (tr|A0A066W7K1|A0A066W7K1_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDN49716.1} KW=Complete proteome; Reference proteome OX=1287689 OS=Rhizoctonia solani AG-8 WAC10335. GN=RSAG8_01781 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MTYTREEYEDPEDEVTRCVCGSEEEVGDFMIQCEQCFVWQHGLCVGLVREEDSPEHYFCE
RCKPENHAALLRDIKHGHYYTNDTNARRYASSR
Download sequence
Identical sequences A0A066W7K1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]