SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A066WC61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066WC61
Domain Number 1 Region: 10-151,237-385
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.66e-62
Family Capz alpha-1 subunit 0.0000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066WC61
Sequence length 417
Comment (tr|A0A066WC61|A0A066WC61_9BASI) Subunits of heterodimeric actin filament capping protein Capz {ECO:0000313|EMBL:KDN51321.1} KW=Complete proteome; Reference proteome OX=1037660 OS=Tilletiaria anomala UBC 951. GN=K437DRAFT_221667 OC=Exobasidiomycetes; Georgefischeriales; Tilletiariaceae; Tilletiaria.
Sequence
MSSSALLTAQAVALLLQTPPGQTSKVYHDLRVLLESSGQSHVSDQLKQQAQPVLEQYNTD
QLITVKPPASADGKVDEKPLIIARAASVAGQNARYADPKAGLSYAFDHLRLALSDPRPLR
VNKSFEKVRAAIDTKVAKYVLDHYQDGVISTFTDPTVPTAAVADVNEEAAKNADEEGKAG
EPEDNQDATDDANVAEGKAEPANDDADPKDDAVETAKALEEVEVTETPGPAMEREKEEPE
PQGAPTYVTHIVGNRYNLSNFWAGRWRSSYTYTPSSSGPSMLQSSIQVQVHYFEDGNVQL
ATSKPAELELDLPAGAGATETKAGAIDDAMAEAVGKAIAQAIKGHEQEYHQTLNEAYAEL
SEKTFKAIRRQLPVTKQKLDWDRVSRLLPCGSSLVINGVETQLTRTILAFPITGLEL
Download sequence
Identical sequences A0A066WC61
XP_013244657.1.10717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]