SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066WL55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066WL55
Domain Number 1 Region: 7-192
Classification Level Classification E-value
Superfamily ITPase-like 3.47e-52
Family Maf-like 0.000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066WL55
Sequence length 194
Comment (tr|A0A066WL55|A0A066WL55_9FLAO) Maf-like protein FEM21_23190 {ECO:0000256|HAMAP-Rule:MF_00528} KW=Complete proteome; Reference proteome OX=1492738 OS=Flavobacterium seoulense. GN=FEM21_23190 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MLRNKLKDYKIILASGSPRRQQFFKDLDIDFEIRLKEIEEIFPAELKREAITNYLAELKA
SAFDGELSENEILVTSDTLVWHNEKAVGKPKDKEDAFAILKSLSNATHEVITSVCFKTNV
KTEVLSEITKVTFNELTDEAIDYYIENYKPFDKAGAYGIQEWIGFIGVKKIEGSYANVIG
LPVDKVYQYLSNLA
Download sequence
Identical sequences A0A066WL55
WP_035660515.1.27337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]