SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A066XC35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066XC35
Domain Number 1 Region: 3-263
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.1e-88
Family Capz alpha-1 subunit 0.00000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A066XC35
Sequence length 271
Comment (tr|A0A066XC35|A0A066XC35_COLSU) Putative F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KDN63321.1} KW=Complete proteome; Reference proteome OX=1173701 OS=Colletotrichum sublineola (Sorghum anthracnose fungus). GN=CSUB01_01978 OC=Colletotrichum.
Sequence
MSQVETVSSFVEGAPPGELADVIADIKSLTVSDPEIVSSLEPAFEKYNEEQFVTVKLPGG
SQQVIISSHSSLGDGQYFDVESSTSFSFDHSTQKASNVQSYVLESANADLIKSTLKSLGP
YVQEHFPNAAYGVYPTANDTQVAIIIVSNKYSPNNFWNGRWRSLYIFDPSSSSLEGSVKV
DVHYYEDGNVRLLTNRPSQASVSSGTGAGIVKEISTSEKKYQEELNRGFTNLSEGAFKGL
RRQLPVTRQKIEWDKITSYRLGQDIGGGARR
Download sequence
Identical sequences A0A066XC35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]