SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066YGG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066YGG7
Domain Number 1 Region: 158-246
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000004
Family Ricin B-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066YGG7
Sequence length 272
Comment (tr|A0A066YGG7|A0A066YGG7_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KDN80588.1} KW=Complete proteome; Reference proteome OX=1348663 OS=Kitasatospora cheerisanensis KCTC 2395. GN=KCH_76370 OC=Kitasatospora.
Sequence
MGMGPRSTAHPFSLPQGGGLPGDGWSDRARGVLRRPSGVPLRGRFFPSRAGGMVGASAGV
AASRPAAGPAVSAQDASVYGGVVQSAGLNRCRGGPHTYDDGYAGPGHLARFLEVNGWAAR
ARRVATWEYVDQNGHAQDNGRWCLERAAGGGWYLRPAYAYRQNGRPDLCLDVLSGHDAAA
SRPRQVWSCNGRLNQRFGFKAGNRTGGRIYAMGSRTYVLRGHHDRARGPSVLQVGGGRAG
RRRWRGAGARVAGSAARRTTGTGREVTGQGRR
Download sequence
Identical sequences A0A066YGG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]