SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067A4P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067A4P5
Domain Number 1 Region: 185-369
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.98e-64
Family Methylesterase CheB, C-terminal domain 0.00000734
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily CheY-like 6.12e-28
Family CheY-related 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067A4P5
Sequence length 371
Comment (tr|A0A067A4P5|A0A067A4P5_9PSED) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1163398 OS=Pseudomonas donghuensis. GN=BV82_0901 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALSLKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPEKVKQ
LLCEKVHTISRSNRRFSAYASPAPAPAPSPQPSVSSLGSTPAPRAAAPARASAAAASASP
APKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKLCK
ISVKEAEDGDILRPGLALLAPGGKQMMVDGRGTVKILPGDERLNYKPCVDITFGSAAKSY
GDKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAVYSLD
EIGKHLVEACV
Download sequence
Identical sequences A0A067A4P5
WP_036994331.1.69248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]