SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067BHT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067BHT3
Domain Number 1 Region: 20-113
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.53e-17
Family Ricin B-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067BHT3
Sequence length 120
Comment (tr|A0A067BHT3|A0A067BHT3_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO17964.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_15370 OC=Saprolegnia.
Sequence
LRTPKGLYLSEWNAGVYANGQVFNVNELFEVDASTQQIKAVSNGQCLDAYKQDGRLRVHT
YTCDASNGNQKWRVVGGKVEHATHTGQCLDVDPTDPHHNVQMWTCIAGNDNQRIELVSQI
Download sequence
Identical sequences A0A067BHT3
XP_012211322.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]