SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067C7T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067C7T7
Domain Number 1 Region: 214-308
Classification Level Classification E-value
Superfamily MIR domain 0.000000327
Family MIR domain 0.0059
Further Details:      
 
Domain Number 2 Region: 83-161
Classification Level Classification E-value
Superfamily MIR domain 0.0000615
Family MIR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067C7T7
Sequence length 2775
Comment (tr|A0A067C7T7|A0A067C7T7_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO22611.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_12592 OC=Saprolegnia.
Sequence
MAGRKRLPGAVYEGDIVVIKIDDRGHVHSDGFVDERLGCISDVAGGKMDGCLFRITPPLQ
YEAQKRLAKAPKAFANAAKLRESTTRGQLVHFGQPLQLQHVQSGKFISTISKTVAEMDKV
CMRLSLVAHGSSKCHFTLVPCFKTKSIGDTVGYNDAVCIARTKSPASFLHMSLHPINMDR
LGRHEINLHTQETMLRLVLYASPHLKSHAAWEAGKVYRLHHIDANAFVTVSANRHMVKAP
YLRPLAASTSVSASENMSLKALFVLERQDRLRGGVLHDVTEPVQFRHLLSGRYLTVLEDG
TVSVRESPPFEILPCTMNEQSTRDICFIQVSGRGYRLHHPSRIKSNRDGRSSQHLQASEQ
LHATRQHSDEDGFRLLPVSASELAEAKFIISAVAFLQAYRGLIASAISRGAPMPRSLVAD
ALAALNAMLHFSSIGHRQKQAREAKVLDVLYEMQRCVLRIEPIARDMATLARDGSFRALH
RVHRLVNRVLVCLLTDNAHNKNYVATRTAQRYYNDATASSTVYARETLGYIGSETGSKTV
YGTLFLNDPTLLATVDASVVAACCKRIEAQGVKAAGILHFLAIICACDGKSVPANQELVV
DVLFAASSSVRDRLLIETCECSTHRRSVPPAIKTMTDALPPALASMTPTPRPLGADILRD
GFSNIAISWKAYTEWRAGDASLFLTSTELGLTPMVGVEKPLDLAAYQAQLTDVSLHAAHA
SEAPTATPVRKGLSLGRLLLASLSHSSSINSEASADSFVADRPIAPIAEESISTEATMTP
AANGNVVTVTPSQRTSIQLSDNASNAEGVDPASTTMGADVDLQPPPPPRHLSSGDEWVEL
EAVVWTLDPDSVYHLVFPGQTWAATLATHRKDKNAKAQFDLLHDLAQYYYLSCFSSSSCF
AAATSMQSRYASVLKPQLSYTMLVAAIANEKLPNTVRMAFTVIMHHCYVMCFPHDHMIFA
TKVHTIESIPALSSRATGPVPLPHFELPPTHPANVLYPADDMRSYPYAIKFQLLQAVLHA
ALSAVATVRVVDATLAQNAFASAILAIVHDLLLCGFYGDYTLQKTLAHVLLCLLDGRNTL
DGSSRYVRSALHDAMTKVKTQICDLLSTMTRLWRHVECVHLLSFFKAKYAHPKSRLLAQS
RAQRRRRLRRQLAAILDKTPHLDLIVVSHLSLNYICMDLLMYEDPELVQAALTLHIETNS
RKARVFEAVLQCLVLESNEAPATRTLALPPTQVLDDVRELLPTLRHLAHLFPDARLCADV
RTAAASGVLAVAQLLLEQLQQLQTYACDKHRLLMERSSKRASTFWGLLSDGPVAVRYTPN
ATGQAILLLLDVHKVALTLLAAQMVADTSVQDAQRQVQAEACKLLVLLSTKNPLGQRLLF
ENLKVLWRLLDTVDGVGDVVLAVFFENAHLSHRLPAEAIWTMGRLIETHAAKLDDAVSGP
KAFATISTIFDFFLTFMAPDDVPLKKHQTAVHNVLHHAQFQHILPDAAASVTPDDDVGSD
AIVQSLDYLAWRTRLQSPKDLRGAYLQKVLIVLAGLAAGKNRGVALHYQKRYPLNWCLSV
LLDAKMPLGFKLVMLRFFTNVYLHGDVDLHLGSTATAVRNVLLQSASLLVDYGSSAGRRF
LSTPRETQFAKLLETYVFDGLLGFITVFCTQHMLARQAEDSDAHVHETLAHALEHVRTNV
TMTSQQTLALDACSRALHTGVHRQDKPRRASHVAVTSEHRDDDATGQLSFHAFQLDIFES
DEVAAVTAAEANRLVVLWAEIERKIGSNQHSSNMTTRLFYTRVMAFLRAQPASPSAELVL
HVLHCLVARCRLDEAVKKRMLLSEIEEANDRCSHTQSFLAACGAPQLVLTLLSGNQSPST
MTQALLLGLELVRGGNIAVQRSFYESFKSGDEQFFATVETILGANIDALKERRRTSKIRI
EGLAPMKSKRRRSSIQAGSAILLPEAYNNALHDTDLVDADLLLQFLTALVAGHFLPTQLL
LLDQRVALGHANSVNILHVVTTYLRLLVKDDVQVRDMTAADCLTLSHCWKFLIECMQGPC
SANQEFLTTSSMVDAFGKVLRAEIAVSTDRVDAPRPDDIKKLKALAVKAMVSLLEGRSND
DVQDRLRSILALPLLKARLIALYTQFHAEKDLHVDDTTWDERFLEEGVNLLTLAKGVFHA
DRLVPPPDRATSAPKRANFTSPIEFQAAAAAYEDAILYRKTYAFFTEMHCAVEVYWRGRI
ELVFFPLPSHCRMLQFLSAKKRALLQSMRYDSNDRLKQFMRALPSMNEEMAHVEALSQFC
VYNALRPYIPLFKTLSFLLAIFMNLIILVSIEHQEQELSDYVYIPSSKLETPMFLCGLLQ
IFLSTAVVVFMLVISIPLVFRRRRNAMRKRALEEYKQRKAFSDTIADSSELDVLKAMAEQ
RVQRWTQTLCAIYSAYLPFAKFIVLLYVCQFAIEHTFPTFPAWTLYTVLFFPVVRSTRTY
LETSGSLLGLLFTFAYDVLVEKLTAFYLVYLCTAVLATFYHPVFYFYHLLDLVIMNPSLQ
NVVLAVTTPARLLGLTALLCLCICYFYAMGLFFFGPANLTDVDRAIPYCATLLDCFVTVL
HRGLAGDGGIGSFMSNALQHPPNFFNRDQYWWRFVFDVTFFALKVVLLNMVFGITIDTFG
DLRTQAARKDDVRRNVCFICGLGRDVFNAHYLASSGLNNGFEKHIADDHNMWSYLYFMVH
VESLDATECTGPEAYVKALLLKHDVAWFPQGMAKCLAPTTTTSVAHDMDDVKNAADVALQ
KFHLRRDRRNSMRSV
Download sequence
Identical sequences A0A067C7T7
XP_012206725.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]