SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067CZJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067CZJ8
Domain Number 1 Region: 340-471
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000124
Family MIR domain 0.0051
Further Details:      
 
Domain Number 2 Region: 202-236
Classification Level Classification E-value
Superfamily MIR domain 0.00000353
Family MIR domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067CZJ8
Sequence length 1070
Comment (tr|A0A067CZJ8|A0A067CZJ8_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO32192.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_03409 OC=Saprolegnia.
Sequence
MQRFTSKRRNLNVDATLAAGTLGESPLSSPLRKELHRPSAHTPLSPNGLLSPRNLPASLD
RVPSEYASKTTSIHAGGHGFLVYGTIVSCLSMDRGGFLAGDGLITSEVRLEGLVQSLKAT
VDLIDAQLTDPGSQRDVHVVACHAKDCLFEVLPKMVYEATAAFEEAKASENASTTSTGFS
DAFSDLKFKSESELRLNANVYDKLHGTRVKYGQTVQLRHIKTGKYIAMQPTRDKETLEVV
LSDGAAACHLTLLPRFKLRKTGEPVQLMDQIVLAATYKAQRFAMHVSTRSAVDGASTLVH
ASLSHASQWRLAPYDHSEKDVSSATMYQPDTGRGLRSGLCIRLLHLETSAWLGCGGGAVH
LQAESGGASDAADTNSHLLSPETLWEVEKSCFLDGGLLHWTDSVCLRHVLTGQYLHVENT
EAGLRVATNAQPQSSYLLRPTTLVNPRNPIGHKSAVLLQHAQTLTYLHTRSSAHLHVSSP
LVTLLTPQDEDAFKIVSVSSTELHDTSRLLAYRTLCESFIASFASASGGDPRLDDVERVL
SQLNTFTFLDTQTPDHVLWLRQTLLHRHQFVPLLTRMLEAPFAAYGGPFSIDYVCGFQPQ
NEPSDGIDELPHTNDFMSPGGGRFSNGVAPPPPPPMDKSLPIVFQWPHTAMRQLHHVLCA
INILLFRMFYSSKTSDTSACRHAMPVLLALLGHGFKASVPLSYLIQEKFHLSESFASFSA
IVRNFFDLIRRHGRAMRYLQFLVVLCSANGHAVPKVQEKICELLFNPSHGYSDAVLVHTR
PTPTGLELCVDAVADKWVPLRTFFDDYYSHKSHATLAPYFYGLLQLYCALCMDRNYTCIR
CLAGSFPRASLLACVQDPALSRSIRAVLLNLLVALHLDCEPQTPLPSPNYTRIWKEVLLH
QDKLPVARDGMYSTDDWTFFGQLQTLAMTYFRKQNGLVIITEAAQNDLTLAFVRLCKKMV
AFGLFRSIAELGALVLELVKLLDSRTDYWYKPSTRSHRELLDATEVVVSPTFFHRSSEST
RFDLQAQNAIIQQTEGGHAMRRASLEPARLATKKTLEYTACVMPLTSRLM
Download sequence
Identical sequences A0A067CZJ8
XP_012197372.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]