SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067D214 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067D214
Domain Number 1 Region: 523-620
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000569
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067D214
Sequence length 636
Comment (tr|A0A067D214|A0A067D214_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO33062.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_01877 OC=Saprolegnia.
Sequence
MVQLSHRLKTLFPLLQWVPTYNIKRDLKFDLIAGVTVAMMIVPQEISLANVMAVPAQYGL
YTAAVTPLLYTIFGTSRVLSVANGSEVSLMVGTYLQTIPDMKERVAVGILISFLVGCINF
ALGCLQLGVVADFFSRPVMGGFLSAGGILIMVAQFPTWLQLSLPTHAYPLQTIYEIFHNF
NKINWISCTIGVLSMLVLSFFKYAKKHLVEAPKLAELLDGPSITQPVTTPREQWGFSLNE
GDYATMEEDHANPTEKNRLGKMPSMQAGKTKAVLLFLLRTLLDLGPLVICFFGILAGYLI
GEKRVKVTGHVPQGMPDIVLPWYGYSDNLIKTDSFGHIFLQAATMALVVYSTSVAIAKRL
AVRGNYDIHSNQELLGLGFASAVGAFFQVMPPTGGMSRTAVNVQSAKTQLASFITVSLVI
LVLLFLTDALYYLPKASLASIIIVAGFWLIEIDEAKWLFKAKRDEFYVWMLSFVLTVGLG
ILPGLFGSIACSLLAVMIKTKRPVVCLLGLNADGHYVDTSVHPEAVMPNDALVVRVEGSL
YFGNAEFLSQYIMTQLVLHAGRRLVVLDTTFLHDIDATSIQTFEILEERLTHLDATVSFA
NARGQAASILSTSGLCKIEPSQSLDQVLLALRRDNS
Download sequence
Identical sequences A0A067D214
XP_012195833.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]