SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067DIU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DIU8
Domain Number 1 Region: 87-156
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 1.14e-19
Family F1F0 ATP synthase subunit C 0.0048
Further Details:      
 
Domain Number 2 Region: 13-77
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000235
Family F1F0 ATP synthase subunit C 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067DIU8
Sequence length 165
Comment (tr|A0A067DIU8|A0A067DIU8_CITSI) V-type proton ATPase proteolipid subunit {ECO:0000256|RuleBase:RU363060} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g031125mg OC=Citrus.
Sequence
MSSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Download sequence
Identical sequences A0A067DIU8
Cucsa.159700.1|PACid:16965233 XP_006487263.1.29302 orange1.1g031125m|PACid:18122156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]