SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067G658 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067G658
Domain Number 1 Region: 44-127
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.79e-22
Family C1-like domain 0.024
Further Details:      
 
Weak hits

Sequence:  A0A067G658
Domain Number - Region: 138-170
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0863
Family PHD domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067G658
Sequence length 185
Comment (tr|A0A067G658|A0A067G658_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO70911.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g037846mg OC=Citrus.
Sequence
MELQHFSHNHPLIFNNDMQTNNHSIDETCCSACGENLSSTSPAGHYGCVECKYFLHKTCA
ELPNEINHFFHPQHPLTLIAEFNSYNYCNACTDLSDGFFYDCVKCNFCIHSTCSSLPRVR
KFECHQHPITLHINPAEESSIRICQICNIKTTPSCVAYYCTDCNFAAHFFINLLPFVIQK
IMVNE
Download sequence
Identical sequences A0A067G658
orange1.1g037846m|PACid:18117998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]