SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067H8C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067H8C6
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-46
Family Capz beta-1 subunit 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067H8C6
Sequence length 132
Comment (tr|A0A067H8C6|A0A067H8C6_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO83846.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g0251062mg OC=Citrus.
Sequence
MEAAMGLMRRMPPKHSETALSALLSLLPDHSSDLLSQVDQPLQVLFDEESGKEFILCEYN
RDADSYRSPWSNKYHPPLEDALYPPAELRKLEIEANEVFAIYRDQYYEGGISSVYMWEDD
NEGFVACFLIKK
Download sequence
Identical sequences A0A067H8C6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]