SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067N6Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A067N6Q0
Domain Number - Region: 49-86
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0471
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067N6Q0
Sequence length 141
Comment (tr|A0A067N6Q0|A0A067N6Q0_PLEOS) Uncharacterized protein {ECO:0000313|EMBL:KDQ23519.1} KW=Complete proteome; Reference proteome OX=1137138 OS=Pleurotus ostreatus PC15. GN=PLEOSDRAFT_1109160 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Pleurotaceae; Pleurotus.
Sequence
MDVDVDVDPLPRQVWVSLPLEDSVIAPSSEPNIPGLVITQSHNKANNKLKVNKTTRNIIV
DGGCICCSSFSSLPYVSLTDSTKWPTESNRIPNNADDELDLQTNHISWILTLPNPEKVHQ
QDASTQTVPEKHKNTNRNLTT
Download sequence
Identical sequences A0A067N6Q0
jgi|PleosPC15_1|162443|genemark.10308_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]