SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067PQX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067PQX7
Domain Number 1 Region: 31-57,177-352
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.22e-52
Family G proteins 0.00000334
Further Details:      
 
Domain Number 2 Region: 61-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 5.23e-33
Family Transducin (alpha subunit), insertion domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067PQX7
Sequence length 355
Comment (tr|A0A067PQX7|A0A067PQX7_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDQ56215.1} KW=Complete proteome; Reference proteome OX=933084 OS=Jaapia argillacea MUCL 33604. GN=JAAARDRAFT_305437 OC=Agaricomycetes; Agaricomycetidae; Jaapiales; Jaapiaceae; Jaapia.
Sequence
MGNCVSGGDADAKARSHQIDKEIHEDSKRLKRECKILLLGSGESGKSTIVKQMKILHQGG
FTDDELLAFRHTIYRNLLDSAQAIVEEMRTSGVECEVEATRPKIDLIAGHSVPVSDDEDY
TFPPEIAQAIYDLWKDPIIPSIMERANQFYIMDNAAYFFDRALRIGTPNYLPTVKDVLRA
RVKSTGIVETRFKMDELSIHMFDVGGQRSERKKWIHCFESVTSIIFCTALSEYDQVLLEE
RKTNRMAESLVLFESVINSRWFLRTSIILFLNKIDVFKQKLPKVPLERYFPEYAGGTDLS
KAAKYILWRFMQMNRARLNVYPHLTQATDTNNIKVVFGAVKETILQNALKESGIL
Download sequence
Identical sequences A0A067PQX7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]