SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067RVV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067RVV3
Domain Number 1 Region: 236-427
Classification Level Classification E-value
Superfamily MIR domain 4.84e-54
Family MIR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067RVV3
Sequence length 668
Comment (tr|A0A067RVV3|A0A067RVV3_ZOONE) Uncharacterized protein {ECO:0000313|EMBL:KDR24004.1} KW=Complete proteome; Reference proteome OX=136037 OS=Zootermopsis nevadensis (Dampwood termite). GN=L798_07946 OC=Termitoidae; Termopsidae; Zootermopsis.
Sequence
FDELHYGKYVSLYMKRTFFFDSHPPFGKQLIAAVAYLAGFDGQFKFDRIGSSYSEVVPLF
ALRLVPAVCGSLILPTTYHLMLELGLTQWTAALAGFLLLCDNAMLTQSRFILMESMLLLF
ALFGLLCILKFRRYHNHPYCLQWWLWLSLGAASLTCALCVKYVGFFSCCLGASVVGRDYW
RLLSERQISDGAVLSIYLTIFYVHLAVLSHAGPHDSVMTSAFQASLEGGLASITRGQPLE
VAHGSQITLRHSHGRTCWLHSHTHVYPIRYPDKRGSSHQQQVTCYSFKDVNNWWIVKRPR
RNDLVVSQPVDAIRHGDVIQLVHGMTSRALNSHDVAAAMSPQNQEVSCYIDYNVSMPAQN
LWRIDIINRDQVGDIWHTIESLVRLVHVNSSQALKFSGRQLPDWGFNQHEVVTDRILHQD
DTVWNVEEHRYTKNEDQKDRERELVNAEMIPLRATTLSFWEKFIELQYKMLFANQENVQN
HMYSSEPLEWPFMARGIAYWVSPHSNAQVHLLGNLVVWLSGSVSLVLYCTLLTFYLIRRR
RQCYDLSPDTWHSFVVVGEVLLSGFLFHYVPYFFVERTLFLHHYLPAFTFKVLLTAALVE
HLHRFLCETLSWRLALAVFKLLTLAWLVAVLVVFRRFSVLSYGTTPLSATDILRLRWRDS
WDFILHRQ
Download sequence
Identical sequences A0A067RVV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]