SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A068D6M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068D6M9
Domain Number 1 Region: 469-579
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068D6M9
Sequence length 593
Comment (tr|A0A068D6M9|A0A068D6M9_9RHIZ) Permease family protein {ECO:0000313|EMBL:AID30240.1} KW=Complete proteome OX=763057 OS=Mesorhizobium huakuii 7653R. GN=MCHK_2427 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MATTLFAATRQKPAMDQLSHAKAASAMSWRRWLPLQALSGWQLRDLNGDLIAGLTLAAIA
IPEQMATARLGGFAPEIGFFAFVAGSVAFALFGANRHLSVGADSTITPLFAGSLALLATS
GSPHYLALAAMLALMVGLIVTLSGVFRLGWIADLLSVPVTTGFLAGIAVHIIVSQMPGLL
GLPAESGETLRRVGEIAGNLHLTNPWSLGLGLGVFAIVFCSERISARIPGALIGMVLATI
AVVVFGLRNHGVEVLGALPNGLPGAYLPVTSLGDVQALVPLALLIAIVVMVQTAATSRSF
ASQQDASPNVNRDFVGVGAGSILSSLFGAFAVNASPPRTAIVSQSGGRSQLSGLTAAAIV
LALGAFGGALLANVPQAALAGVLMFVAQHILRWKVFAGVYRQAPVEFVLILVTMAAIVVL
PIATGVAVGIGLSLLHGIWSATRTEPIELEQVPGTSVWWPPAKPSAGEQLPGVLVVAFQA
PLSFVNADRFKRGVCDLVDARDETVKLVVLEASNIVEIDYTAAQALIDTILHCRKAGAVF
AIARLESLRAQAALARFGIAEMVGPQRIFHSVDAAIKSLSPGKQQQQGQDGVS
Download sequence
Identical sequences A0A068D6M9
WP_019858286.1.37186 WP_019858286.1.54613 WP_019858286.1.60724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]