SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068D8N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068D8N5
Domain Number 1 Region: 11-168
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 1.01e-52
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000684
Further Details:      
 
Domain Number 2 Region: 183-246
Classification Level Classification E-value
Superfamily PGBD-like 2.94e-17
Family Peptidoglycan binding domain, PGBD 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068D8N5
Sequence length 251
Comment (tr|A0A068D8N5|A0A068D8N5_9RHIZ) N-acetylmuramoyl-L-alanine amidase family protein {ECO:0000313|EMBL:AID30995.1} KW=Complete proteome OX=763057 OS=Mesorhizobium huakuii 7653R. GN=MCHK_3192 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MSGFLPDEPSAEVRVSPNFGPRRDTLKPDMIVLHYTGMPTGAGAEAWLCDPASEVSSHYL
VHESGHIVQMVRESDRAWHAGKSSWFGRTDINSCSVGIEIVNPGHSLGYPGFPRRQIEAV
IGLCNGITARHAIPAMRVLAHSDVAPGRKIDPGEKFPWAALFAAGVGHLVPAAPIRRGTA
LKPGDSGADVEGLQSMLTLYGYGVEISGVFDHQTRIVVEAFQRHFRPRLVDGLADGSTMR
TLQKLLASVSG
Download sequence
Identical sequences A0A068D8N5
WP_038647743.1.37186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]