SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A068MXL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068MXL0
Domain Number 1 Region: 445-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000471
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068MXL0
Sequence length 556
Comment (tr|A0A068MXL0|A0A068MXL0_SYNY4) Sulfate permease {ECO:0000313|EMBL:AIE74714.1} KW=Complete proteome OX=1147 OS=6714)). GN=D082_21860 OC=Synechocystis.
Sequence
MATTLLSPTRFVHGLRFDNLRGDIFGGITAAIVALPLALAFGVASGAGPMAGLYGAICTG
FFAALFGGTPAQISGPTGPMTVVIASTFANLTASNPENSWAMALTVVMFGGIFQVVLGLL
GLGKYITFMPYTVISGFMSGIGVIIVILQIAPLLGHQTAPGVVASLQAIPTYLSDVNFAA
LGLGLVALAIVFFSPPRINRILPAPLIALVLGTVISVIFFGHVPLPRIGEIPSGLPSLHL
PYLSWGSLQQMLLYSIMLAVLGSLDSLLTSLVADNISRSHHDSDRELVGQGIGNFISGLC
GGLPGAGATMRTVININSGGRTPIAGMIHALILLIIVLKAGQLTEPIPHAVLAGILIKVG
IDIVDWSFLKRAHQLSTKGAGLMYLVLGLTVFVDLITAVAVGVFVANLFTVKNLTDLQLD
SIKSVTRADGEDWLLEEEQQILREANGRIFMFHLSGPMSFGAAKSIARRLAIVENYDVLI
LDLATVPRLGITALLAIETMLKDALAKQREVFLVGAKGQVQARLQQLPVLGQLSPHHRLE
SRLLALQMAAACINVD
Download sequence
Identical sequences A0A068MXL0
WP_028947824.1.709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]