SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068MZX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068MZX9
Domain Number 1 Region: 48-124
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 2.75e-21
Family F1F0 ATP synthase subunit C 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068MZX9
Sequence length 126
Comment (tr|A0A068MZX9|A0A068MZX9_SYNY4) Lipid-binding protein {ECO:0000256|HAMAP-Rule:MF_01396} KW=Complete proteome OX=1147 OS=6714)). GN=D082_29120 OC=Synechocystis.
Sequence
MPNAYLGRCLLQELSLSPELFLIWWNFTPKILNFTVVLLAKRKKIMDSTVAAASVIAAAL
AVGLGAIGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLL
FANPFA
Download sequence
Identical sequences A0A068MZX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]