SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068NDX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068NDX8
Domain Number - Region: 51-120
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.068
Family Formin homology 2 domain (FH2 domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068NDX8
Sequence length 275
Comment (tr|A0A068NDX8|A0A068NDX8_BACCE) Cell division protein FtsX {ECO:0000256|PIRNR:PIRNR003097} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=BcrFT9_04146 OC=Bacillus cereus group.
Sequence
MTFASVSAVTVTLLLVGVFLTAIMNMNHFATKVEQDVEIRVHIDPAAKEADQKKLEDDMS
KIAKVESIKYSSKEEELKRLIKSLGDSGKTFELFEQDNPLKNVFVVKAKEPTDTATIAKK
IEKMQFVSNVQYGKGQVERLFDTVKTGRNIGIVLIAGLLFTAMFLISNTIKITIYARSTE
IEIMKLVGATNWFIRWPFLLEGLFLGVLGSIIPIGLILVTYNSLQGVFNEKLGGTIFELL
PYSPFVFQLAGLLVLIGALIGMWGSVMSIRRFLKV
Download sequence
Identical sequences A0A068NDX8 C2R0S1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]