SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068RM60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068RM60
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 2.22e-38
Family Transthyretin (synonym: prealbumin) 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068RM60
Sequence length 132
Comment (tr|A0A068RM60|A0A068RM60_9FUNG) 5-hydroxyisourate hydrolase {ECO:0000256|RuleBase:RU361270} KW=Complete proteome; Reference proteome OX=1263082 OS=Lichtheimia corymbifera JMRC:FSU:9682. GN=LCOR_02914.1 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MSASSRLAAVKQHLTPMSKSPITCHVLVASVGKPGEHVRVKIEKEGAAGAFSVLSTAETN
DDGRCPNLLPSDYKVEKGVYRVTFETKEFFARKGEKCFYPYVQIVFEIEHPEQHYHIPLL
ISPYSYTTYRGS
Download sequence
Identical sequences A0A068RM60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]