SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A068RMV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068RMV4
Domain Number 1 Region: 418-449,485-549
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000589
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068RMV4
Sequence length 699
Comment (tr|A0A068RMV4|A0A068RMV4_9FUNG) Sulfate permease {ECO:0000313|EMBL:CDH51339.1} KW=Complete proteome; Reference proteome OX=1263082 OS=Lichtheimia corymbifera JMRC:FSU:9682. GN=LCOR_02961.1 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MSLLLGQTIIRSTSAEGSTMTGPDIAVTFSLLAGATILFIGLVRLGILVDFIPGPVIAAF
MTGSAITITFSQLKSLTGISEIDTQDPAYLILGHFFQYIPHMKLDAAFGAAGLIWLYSIQ
HGCQWLAKRYPRYGTAIYMFSIMRNGILVIFGTLIAFLINLGKDTSPISILESVPAGFQA
MGVPNVNTELAAAVAPSLPSGVIVLILEHVAIAKSFGRMNDYTIRPSQEIAAIGFTNVVA
AFFGAYPSTGSFSRTAIVSRSGVKTPLCGVFAAAVVLLALYALTPAFYYIPDSILAAVVI
HAVANLVSGPKYIKRLASVSLWELFVFAVGVIVIFFTSVEYGIYASVALSIVILLFRIAR
PRFWALGRIPLASTATSPPPSSDTEKPPLPAPSDNDEKKHQQYLYVPESNPSLGHLVEPL
PPGILMCRVDESFTYPNSSYISEKIIDYCKSRTRRDYGDDQGGKVDRPWNDAGNNKDADV
PPEEQAPLLHALVIDFASVNRLDSSGLQGLLDAQNTLNRYSGHHVEFHFVAILSPAIRRS
LIIAGFGTQPTMHYVSEPTEVLPVVPSNNNIASTAPPSMYHASSRGGYTADDDDDDVERA
MSSVSSDSGGGGVRSSNTNKKYSHHGIEEHQVEDVVADGSANVSMHSARSIPLPKDKYPF
FHWSADEAVRASVASMAARNAEERQQKEEQQQPQQNQQQ
Download sequence
Identical sequences A0A068RMV4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]