SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068UM26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068UM26
Domain Number 1 Region: 28-156
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 2.88e-33
Family Eukaryotic RPB5 N-terminal domain 0.00098
Further Details:      
 
Domain Number 2 Region: 153-228
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 3.79e-25
Family RPB5 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068UM26
Sequence length 228
Comment (tr|A0A068UM26|A0A068UM26_COFCA) Uncharacterized protein {ECO:0000313|EMBL:CDP09516.1} OX=49390 OS=Coffea canephora (Robusta coffee). GN=GSCOC_T00028911001 OC=Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea.
Sequence
MDVGGKMEMDVDGESYPRCLSSYIDEGSIESHRYYLSRRTVLEMLRDRGFLVPNSEIGLS
LQDFRNNYGQQPDIDRLRISALHKDDPSNKILVLFCGPNVVKVNVIRGIANQIMNKDTLS
RLILIVQNHITSQAMKAVDLLPFKVEIFQITDLLVNVTKHVLKPKHQLLTEEEKQRLLEK
YNIEDKQLPRMLQKDAIARYYGLEKGQVLKVTYNNEITETHVTYRCVW
Download sequence
Identical sequences A0A068UM26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]