SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068UUQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068UUQ6
Domain Number 1 Region: 32-119
Classification Level Classification E-value
Superfamily MIR domain 6.54e-31
Family MIR domain 0.00019
Further Details:      
 
Domain Number 2 Region: 123-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-22
Family G proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068UUQ6
Sequence length 215
Comment (tr|A0A068UUQ6|A0A068UUQ6_COFCA) Uncharacterized protein {ECO:0000313|EMBL:CDP11358.1} OX=49390 OS=Coffea canephora (Robusta coffee). GN=GSCOC_T00033568001 OC=Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea.
Sequence
MGSSQAAFFGLAIFLFLTLDSDFISSPISTASEGIQITYGSVIKLMHERTKFRLHSHDVS
YGSGSGQQSVTGFPNVDDSNSYWIVRPVPDTNAQQGDTIKGDTIIRLQHMRTRKWLHSHL
LNVTSEAGGITQGMGAYKVQVLFDGKPQTCVFLDTPGHEAFRAMRARGARVIDIVVIVVA
TDDGIRPQTEEAIAHAKAAGVRIVIAINKVCLHLF
Download sequence
Identical sequences A0A068UUQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]