SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A068VDY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068VDY9
Domain Number 1 Region: 29-122
Classification Level Classification E-value
Superfamily MIR domain 1.31e-27
Family MIR domain 0.00028
Further Details:      
 
Domain Number 2 Region: 121-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000835
Family G proteins 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068VDY9
Sequence length 186
Comment (tr|A0A068VDY9|A0A068VDY9_COFCA) Uncharacterized protein {ECO:0000313|EMBL:CDP18956.1} OX=49390 OS=Coffea canephora (Robusta coffee). GN=GSCOC_T00010973001 OC=Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea.
Sequence
MAISFFGLAIFLFLTLDSDFTSSPISTASEGVQITYGLVIMLMHERTKFRLHSHDVPYGS
GSGQQSVTGSPNIDDSNSYWIVRPVPDTNAQQRDTIIKCGTIIRLQHMRTRKWLYSHLLN
TTLLDYIRKSKVAASEAGGITQGMGAYKVQVPFDGKPQTCVFLDTPGHEKRPLLMPKQLE
CELLLL
Download sequence
Identical sequences A0A068VDY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]