SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068WAZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068WAZ0
Domain Number - Region: 132-176
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0288
Family Supernatant protein factor (SPF), C-terminal domain 0.026
Further Details:      
 
Domain Number - Region: 48-92
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.0575
Family ERP29 C domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068WAZ0
Sequence length 211
Comment (tr|A0A068WAZ0|A0A068WAZ0_ECHGR) Pfam-B_7133 domain containing protein {ECO:0000313|EMBL:CDS16849.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_000955750 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MAAVVDALRYCFEVRETGASESCRVCEKAFDEDLITINEKWNSDTKLGREYYYVEHFNRK
IAELLQKREEYDKKEAQRMEILKAKLLSVEGCDKQMVTRENIDERLDEIMSSPPVQFNYS
VSERGKTIHPESLGDLPSLYCYVHMSSKKVFSSSHTFSTAASVVYCFRNTLSIMTTSCLG
GSRSSIRMRINLEPVSIIGYSFASCFFTLFG
Download sequence
Identical sequences A0A068WAZ0
EgrG_000955750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]