SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068X8D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068X8D7
Domain Number 1 Region: 27-164
Classification Level Classification E-value
Superfamily BEACH domain 1.83e-52
Family BEACH domain 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068X8D7
Sequence length 168
Comment (tr|A0A068X8D7|A0A068X8D7_HYMMI) Neurobeachin {ECO:0000313|EMBL:CDS27071.2} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000717900 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MFALPDEAIVRRVIYALPPVGIGIRYGVPQSHRISLAPGRQHLSLSQATQRWQRREMSNF
DYLMCLNTLAGRSFNDLNQYPIFPWVLSNYTSKHLDLNEPANYRDLSKPVGALSPARKAF
FDERYADWDDPTQPAFHYGTHYSTAAFLLNYLIRLEPFTTMFLNIFQI
Download sequence
Identical sequences A0A068X8D7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]