SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XJE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XJE8
Domain Number 1 Region: 8-142
Classification Level Classification E-value
Superfamily BEACH domain 3.01e-55
Family BEACH domain 0.000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068XJE8
Sequence length 273
Comment (tr|A0A068XJE8|A0A068XJE8_HYMMI) Neurobeachin {ECO:0000313|EMBL:CDS30185.2} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000036300 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MLMAYSSRKGGKFDHPNRLFYSVAATWSGCLEISTNVKEHIPEFLYLPEMFENTNGYDFG
TLDDGTKLGDVELPPWATSPEEFVRIHRQALESDLVSCQLHHWIDLIFGYKQRGPEAVKA
VNTFHYLTYEGSVNVLKREAPSENRCSKITSPIAKSQNVESTEASLEMDAETSSGQPILQ
PSAPSSNFPTSATLPFSLPESHSMPLLTLDSNPLASNVIGNRWYMGENMDPSVRLSANNF
VVTADGRAIVTCGYCDYSFRIFAVSSGLSNVLL
Download sequence
Identical sequences A0A068XJE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]