SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XR75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XR75
Domain Number 1 Region: 11-199
Classification Level Classification E-value
Superfamily ITPase-like 2.88e-53
Family Maf-like 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068XR75
Sequence length 206
Comment (tr|A0A068XR75|A0A068XR75_HYMMI) Maf protein {ECO:0000313|EMBL:CDS32586.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000082100 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MLTALQNKLAKYSIVLASTSPRRKEILSTCGLKFTAFDPKAPEDLNPAEFPTISVFVEAL
ARLKAEHAIRRLTQSADIIIAADTVVAFEDRILGKPVDAEDAIRTLTALSGKFHSVYTGV
CVVWMGNEPEFCCFSECTEVKMAKLSKGVVEGYVKTGEPLDKAGSYGIQGIGCSLVSEIK
GDYFNIVGLPIHKLCEHIHNKLANEA
Download sequence
Identical sequences A0A068XR75
HmN_000082100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]