SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A068XU05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XU05
Domain Number 1 Region: 25-189
Classification Level Classification E-value
Superfamily MIR domain 2.35e-49
Family MIR domain 0.00000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068XU05
Sequence length 206
Comment (tr|A0A068XU05|A0A068XU05_ECHMU) Stromal cell derived factor 2 {ECO:0000313|EMBL:CDS35810.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_001176500 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MRNPLLFVVSLTLSLLCVSAKKNALVTCGSLVKLVNTDYGVRLHSHDVSYGSGSKQQSVT
GIKDITDGGSYWQIKNEDKNDYFCRGEPVKCGQIIRLTHSASGKNLHSHHFQSPLSHNYE
VSAFGKNGVGDEGDNWMVICSDNNWTRETLIKLRHLSTLGYLYVSGSTYSHPIPGQFEIS
SSNSAYGSSWKVAEGIINNSLKRTVH
Download sequence
Identical sequences A0A068XU05
EmuJ_001176500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]