SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A068Y4L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068Y4L9
Domain Number 1 Region: 172-373
Classification Level Classification E-value
Superfamily MIR domain 4.32e-30
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 53-138
Classification Level Classification E-value
Superfamily MIR domain 0.0000000288
Family MIR domain 0.017
Further Details:      
 
Domain Number 3 Region: 434-533
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000000445
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 4 Region: 661-733,762-819
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000791
Family SPRY domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068Y4L9
Sequence length 928
Comment (tr|A0A068Y4L9|A0A068Y4L9_ECHMU) Ryanodine receptor 44f {ECO:0000313|EMBL:CDS38121.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000544500 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MCSLESIAKEVPPANMPPCIFILEQALSARALQEMLSSRNELSDSHTSGHRTLLYGHAIR
LKHRNSSMYLACLGTSSTEDKLAFDVGLERKANTEACWWTIHPASKQRSVGEKVRIGDDL
ILVSVSSERYLHVYGDSFSSSGVIASFQQTLWTVIPVSSGAVRQKSLHMAFGGDVVRLFH
GDECLTIQAAGDTEEGQIISNEAASSSDYHQSVMYQLGSVSGHASSLWQIEHTKIKWCAG
FFSWEDAVRLRHVTTGRYLGITHSGAGGNPSAPGQIDVVLLSPSESDDAATVFYIKQTKD
DKKKVEIDREHEGMGEPDVCLGETLIYLQHAALGWWLSYESYETKKRGVGKVEEKKAVLL
AEGHMDDVFSLVRAQEEESLSAAAIRRSTAVFSAFNRSLDALASSDGLGGGGGGAAGAAS
SPATGPGDVPLNLDEVNQCLEDLIEFFAQPETHEEHEARQSKLAALANRQDLFQEEGMIS
LVLETIDKFTGTFRSRRDFALAVGEERGSRFSDLGNYLYLLLAALIRGNRENCAQFAAPA
RLDWLFNRLELQQSFAEGVLDALHCVLTDSDEALNVITAQHIHTLIGLLDKQGRDPRVLE
VLYSICIGRQGGAVRLNQDLIYESLLPERDLLLQTKLVAQSGSMRPNIFVGIKPGGSMYT
KWYFEVFIDALENVTHQPPGIRIGWGNTDGYTPHPVGGPGWGGISLGDDFYSFAFDGQNL
WTGGKAKQALFPPRTGGKGLNRRTGASPSAVSTTSSNGSANLKRGDVIGCLLDLTGPVIQ
FNLNGNLVKGYFQDFNTTGLFFPCVSMTARASARFVLGGTHGKLKHGPPAGYAPIIDALQ
PSQRLRLEPVFSFGRLDKSIFSGPLASPLPSQDVFVPVPISTDKIHLPNVVERIRDKLAE
NLHELWSMRKIEQGWAFGESQLTKNLMP
Download sequence
Identical sequences A0A068Y4L9
EmuJ_000544500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]